KEGG   Methanosaeta harundinacea: Mhar_2219Help
Entry
Mhar_2219         CDS       T01990                                 

Definition
Pyruvate:ferredoxin oxidoreductase subunit C
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_2219
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_2219
   00020 Citrate cycle (TCA cycle)
    Mhar_2219
   00620 Pyruvate metabolism
    Mhar_2219
   00640 Propanoate metabolism
    Mhar_2219
   00650 Butanoate metabolism
    Mhar_2219
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhar_2219
   00680 Methane metabolism
    Mhar_2219
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mhar_2219
Enzymes [BR:mhi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mhar_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2383460..2384122)
Genome map
AA seq 220 aa AA seqDB search
MGNSLLKAPVGYKNVVMRRRRFRLRKGYILSPPHADEEVSRLKEIRFHGRGGQGAVTAAE
LIAIAAFEDKKYSQAFPAFGVERRGAPVMAFARIASEPIRIRSQIYEPDYVIVQDVTLLE
VVDVASGLKPEGKIIINTDRDPKDLKLKTGAEVVTIDATRIALEKLGRPIVNTTMLGAFC
GATGEVSLESVNKAILSRFSGSLGEKNLAAIKTAYEGVSR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactctctccttaaggctcccgtcggatataaaaatgtggtgatgcgccgccgt
cgattccgtctccgaaaaggctatatcctgtccccgcctcacgccgatgaggaggtcagc
cggttgaaggagattcgatttcacggccggggtggccagggagctgtcactgctgctgaa
ttgatagcaattgcggcttttgaggataaaaagtactcccaggctttccccgcctttggt
gtggagcggcgaggcgctccagtcatggcttttgcccgaattgccagcgagccgatccgg
atcagaagccagatctacgagcccgattacgtcatcgtccaggatgtgaccctcctggag
gtcgtagacgtggcgagcggcctcaagccggaggggaagatcatcatcaacaccgacagg
gatccaaaggacctcaagctcaagaccggggcggaggtcgtcaccatcgatgccaccagg
atcgccctcgagaagctggggaggccgatcgtcaacaccaccatgctcggagccttctgc
ggcgccaccggcgaggtgagcctcgagagcgtaaacaaggcgattctgagccggttcagc
ggctccctgggcgagaagaacctggcagccataaagaccgcttacgagggggtcagccga
tga

DBGET integrated database retrieval system