KEGG   Methanosaeta harundinacea: Mhar_2219Help
Entry
Mhar_2219         CDS       T01990                                 

Definition
Pyruvate:ferredoxin oxidoreductase subunit C
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_2219
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_2219
   00020 Citrate cycle (TCA cycle)
    Mhar_2219
   00620 Pyruvate metabolism
    Mhar_2219
   00640 Propanoate metabolism
    Mhar_2219
   00650 Butanoate metabolism
    Mhar_2219
  Energy metabolism
   00680 Methane metabolism
    Mhar_2219
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mhar_2219
Enzymes [BR:mhi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mhar_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2383460..2384122)
Genome map
AA seq 220 aa AA seqDB search
MGNSLLKAPVGYKNVVMRRRRFRLRKGYILSPPHADEEVSRLKEIRFHGRGGQGAVTAAE
LIAIAAFEDKKYSQAFPAFGVERRGAPVMAFARIASEPIRIRSQIYEPDYVIVQDVTLLE
VVDVASGLKPEGKIIINTDRDPKDLKLKTGAEVVTIDATRIALEKLGRPIVNTTMLGAFC
GATGEVSLESVNKAILSRFSGSLGEKNLAAIKTAYEGVSR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactctctccttaaggctcccgtcggatataaaaatgtggtgatgcgccgccgt
cgattccgtctccgaaaaggctatatcctgtccccgcctcacgccgatgaggaggtcagc
cggttgaaggagattcgatttcacggccggggtggccagggagctgtcactgctgctgaa
ttgatagcaattgcggcttttgaggataaaaagtactcccaggctttccccgcctttggt
gtggagcggcgaggcgctccagtcatggcttttgcccgaattgccagcgagccgatccgg
atcagaagccagatctacgagcccgattacgtcatcgtccaggatgtgaccctcctggag
gtcgtagacgtggcgagcggcctcaagccggaggggaagatcatcatcaacaccgacagg
gatccaaaggacctcaagctcaagaccggggcggaggtcgtcaccatcgatgccaccagg
atcgccctcgagaagctggggaggccgatcgtcaacaccaccatgctcggagccttctgc
ggcgccaccggcgaggtgagcctcgagagcgtaaacaaggcgattctgagccggttcagc
ggctccctgggcgagaagaacctggcagccataaagaccgcttacgagggggtcagccga
tga

DBGET integrated database retrieval system