KEGG   Methanosaeta harundinacea: Mhar_2251Help
Entry
Mhar_2251         CDS       T01990                                 

Definition
(GenBank) Pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mhar_2251
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhar_2251
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhar_2251
Enzymes [BR:mhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mhar_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2412858..2414210
Genome map
AA seq 450 aa AA seqDB search
MQTKILLDEEEMPKRWYNVAADLLTPLDPPLHPQTGKPLSPTDLEAIFPKELIRQEMSTE
RWINIPDEVREILKLWRPTPLFRAHRLEEHLKTPAKIYYKYEGVSPAGSHKPNTAVAQAY
FNMKAGIERIATETGAGQWGSALSMATSFFGLACRVYMVRASFDQKPYRKSIMQVWGAEC
VASPSELTNAGRMILKEHPDTGGSLGIAISEAVEDAATHDNTNYALGSVLNHVLLHQTVE
GQELKEQLAIVDDYPDVIYGCVGGGSNFPGMCFPFVPDKLKEKKEIRMVACEPAACPTLT
KGIYTYDFGDTAKLTPLLKMYTLGHDFIPPSIHAGGLRYHGDAPLLCNLVHDGVIEAMSF
HQNEVFQAAVTFARTEGILPAPESSHAIKPAIDDAIACKKTGEEKTIVISLSGHGHFDLS
SYDAYFAGNLVDYEYPEELVKQSLAKIPKF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaactaaaattctgctggatgaagaagagatgccgaagcggtggtacaacgtcgcc
gcagacctcctgacccccctggacccgcccctccacccccagacgggaaagcccctgtct
ccaactgacctggaggcgatcttcccgaaggagctgatccgtcaggagatgtccaccgag
cggtggatcaacattcccgacgaggtccgggagatcctcaagctctggaggccgaccccc
ctcttccgggcccaccggctcgaggagcacctcaagaccccggcgaagatttattacaag
tacgagggggtgagccccgccgggagccacaagcctaacaccgccgtagcccaggcctac
ttcaacatgaaggccggaatcgagaggatcgccaccgagaccggcgccggccagtggggc
tcggctctctccatggccacgagcttcttcggcctcgcctgccgggtctacatggtccgg
gcctccttcgaccagaagccgtaccggaagtccatcatgcaggtctggggcgccgagtgc
gtcgcgagccccagcgagctgacgaacgccggcaggatgatcttgaaggagcaccccgac
accggcggaagcctggggatcgccatctccgaggcggtcgaggacgccgcgacccacgac
aacaccaactacgcattgggatcggtcttaaaccacgtcctcctccaccagactgtggag
ggccaggagctgaaggagcagcttgcgatcgtcgacgattaccccgacgtcatatacggc
tgcgtcggcggaggctccaacttccccgggatgtgcttccccttcgtccccgacaaattg
aaggagaagaaggagatcaggatggtcgcctgcgagcccgccgcctgcccgaccctgact
aaggggatctacacctacgacttcggggacacggcgaagctcacccccctcctcaagatg
tacaccctcggccacgacttcatcccgccctcgatccacgccggagggctccgataccac
ggcgacgcccccctcctctgcaacctcgtccacgacggcgtcatcgaggcgatgtccttc
caccagaacgaggtcttccaggcggccgtcaccttcgccaggaccgaggggatcctcccc
gcccccgagtcctcccacgccataaagcccgccatcgacgacgccatcgcctgcaagaag
accggcgaggagaagacgatcgtcatctccctcagcggccacggccacttcgacctctcc
agctacgacgcctacttcgcaggaaacctggtggactacgaataccccgaggagctggtg
aagcagtccctggcgaagatccccaagttctga

DBGET integrated database retrieval system