KEGG   Methanosaeta harundinacea: Mhar_2251Help
Entry
Mhar_2251         CDS       T01990                                 

Definition
Pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mhar_2251
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhar_2251
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhar_2251
Enzymes [BR:mhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mhar_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2412858..2414210
Genome map
AA seq 450 aa AA seqDB search
MQTKILLDEEEMPKRWYNVAADLLTPLDPPLHPQTGKPLSPTDLEAIFPKELIRQEMSTE
RWINIPDEVREILKLWRPTPLFRAHRLEEHLKTPAKIYYKYEGVSPAGSHKPNTAVAQAY
FNMKAGIERIATETGAGQWGSALSMATSFFGLACRVYMVRASFDQKPYRKSIMQVWGAEC
VASPSELTNAGRMILKEHPDTGGSLGIAISEAVEDAATHDNTNYALGSVLNHVLLHQTVE
GQELKEQLAIVDDYPDVIYGCVGGGSNFPGMCFPFVPDKLKEKKEIRMVACEPAACPTLT
KGIYTYDFGDTAKLTPLLKMYTLGHDFIPPSIHAGGLRYHGDAPLLCNLVHDGVIEAMSF
HQNEVFQAAVTFARTEGILPAPESSHAIKPAIDDAIACKKTGEEKTIVISLSGHGHFDLS
SYDAYFAGNLVDYEYPEELVKQSLAKIPKF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaactaaaattctgctggatgaagaagagatgccgaagcggtggtacaacgtcgcc
gcagacctcctgacccccctggacccgcccctccacccccagacgggaaagcccctgtct
ccaactgacctggaggcgatcttcccgaaggagctgatccgtcaggagatgtccaccgag
cggtggatcaacattcccgacgaggtccgggagatcctcaagctctggaggccgaccccc
ctcttccgggcccaccggctcgaggagcacctcaagaccccggcgaagatttattacaag
tacgagggggtgagccccgccgggagccacaagcctaacaccgccgtagcccaggcctac
ttcaacatgaaggccggaatcgagaggatcgccaccgagaccggcgccggccagtggggc
tcggctctctccatggccacgagcttcttcggcctcgcctgccgggtctacatggtccgg
gcctccttcgaccagaagccgtaccggaagtccatcatgcaggtctggggcgccgagtgc
gtcgcgagccccagcgagctgacgaacgccggcaggatgatcttgaaggagcaccccgac
accggcggaagcctggggatcgccatctccgaggcggtcgaggacgccgcgacccacgac
aacaccaactacgcattgggatcggtcttaaaccacgtcctcctccaccagactgtggag
ggccaggagctgaaggagcagcttgcgatcgtcgacgattaccccgacgtcatatacggc
tgcgtcggcggaggctccaacttccccgggatgtgcttccccttcgtccccgacaaattg
aaggagaagaaggagatcaggatggtcgcctgcgagcccgccgcctgcccgaccctgact
aaggggatctacacctacgacttcggggacacggcgaagctcacccccctcctcaagatg
tacaccctcggccacgacttcatcccgccctcgatccacgccggagggctccgataccac
ggcgacgcccccctcctctgcaacctcgtccacgacggcgtcatcgaggcgatgtccttc
caccagaacgaggtcttccaggcggccgtcaccttcgccaggaccgaggggatcctcccc
gcccccgagtcctcccacgccataaagcccgccatcgacgacgccatcgcctgcaagaag
accggcgaggagaagacgatcgtcatctccctcagcggccacggccacttcgacctctcc
agctacgacgcctacttcgcaggaaacctggtggactacgaataccccgaggagctggtg
aagcagtccctggcgaagatccccaagttctga

DBGET integrated database retrieval system