KEGG   Methanosaeta harundinacea: Mhar_2263Help
Entry
Mhar_2263         CDS       T01990                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_2263
   01230 Biosynthesis of amino acids
    Mhar_2263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_2263
   00030 Pentose phosphate pathway
    Mhar_2263
   00051 Fructose and mannose metabolism
    Mhar_2263
  Energy metabolism
   00680 Methane metabolism
    Mhar_2263
Enzymes [BR:mhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mhar_2263
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mhar_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2425750..2426862
Genome map
AA seq 370 aa AA seqDB search
MTKITISLIKADVGGWPGHATVHPALKETAESVLSQEKAKGEIIDFKVMSVGDDLQLMMT
HQRGVDNAEIHGLAWEVMCKATEKAKELKLYGAGQDLLCDAFCGNIKGMGPGVAEMEFEE
RAAEPVVAFMMDKTEPGAFNLPIFRIFADPFNTAGLVIDPSIHQGFVFEVWDIMEHKKVM
MDSPEEMYDILALIGAKSRYVIKRVYPKAGKLPEDEPAAVVSTEKLYQTAGTYVGKDDPV
ALVRAQSGLPALGEVLEPFSLGHLVSGWMRGSHNGPLMPCAFEDAVCTRFDGPPRVIAAG
FQIAKGMLIGPVDLFRDPAFDLTRQRVHEITDYMRRHGPFEPHRLPMEDMEYTTLPHVLK
NLGERFADAD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatcaccatcagcttgatcaaggcagacgtcggaggatggcccggccacgcc
accgtccaccccgcactgaaggagaccgccgagtcggtcctatcccaggagaaggcgaaa
ggcgagatcatcgacttcaaggtgatgtccgtcggcgacgacctccagctcatgatgacc
caccagcggggagtggacaacgccgagatccacggcctcgcctgggaggtgatgtgcaag
gcgacggagaaggcgaaggagctgaagctctacggcgcgggccaagacctcctctgcgac
gccttctgcggaaacatcaaggggatggggccgggagtcgccgagatggagtttgaagag
agggcggccgagccggtcgtcgccttcatgatggacaagacggagccgggggccttcaac
ctcccgatcttcaggatattcgccgaccccttcaacaccgcaggcctcgtcatcgacccc
agcatccaccaggggttcgtcttcgaggtctgggacatcatggagcacaagaaggtgatg
atggactcccccgaggagatgtacgacatcctcgccctcatcggcgccaagagcaggtac
gtcatcaagagggtctaccccaaggcggggaagctccccgaggacgagcccgccgccgtc
gtcagcaccgagaagctctaccagaccgccgggacctacgtcggaaaggacgaccccgtc
gccctggtcagagcgcagtcggggctccccgccctcggggaggtcttggagcccttctcc
ctcggccacctcgtcagcggctggatgagggggagccacaacggccccctgatgccctgc
gccttcgaggacgccgtctgcaccaggttcgacggccccccccgggtcatagccgccggg
ttccagatcgcgaaagggatgctgatcggccccgtcgacctcttccgggaccccgccttc
gacctgacgaggcagagggttcacgagatcaccgattacatgcgccgccacggccccttc
gagccccaccgcctgccgatggaggatatggagtacaccaccctcccccacgtcctcaag
aacctgggggagaggttcgcggacgccgattga

DBGET integrated database retrieval system