KEGG   Mycoplasma hyopneumoniae J: MHJ_0029Help
Entry
MHJ_0029          CDS       T00260                                 

Gene name
parC
Definition
DNA topoisomerase IV subunit A (EC:5.99.1.-)
Orthology
K02621  
topoisomerase IV subunit A [EC:5.99.1.-]
Organism
mhj  Mycoplasma hyopneumoniae J
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(33802..36342)
Genome map
AA seq 846 aa AA seqDB search
MNKSLDSVINSQLEKILAEKFIRYSKYVIQQRAIPDVKDGLKPVQRRILYSMWQLGLKNS
KNYKKSARVVGDVIGKYHPHGDSSIYDALVRLAQEWKMNSPLVEMHGNKGSIDDDPPAAM
RYTEVRLAEISEHLLELISKNVVSFCPNFDDSEKEPTILPAIFPNLLINGAIGIASGFAT
EIPPHNLGEVIDAAILMIKNPGITIEEISTIILGPDFPTGGIVYGKSGIFDAFKTGKGKI
KISSDYKIFEKNGQNVIEITSIPFGISKSSLIEEIDDIRFDVKIYGIKNVIDQSDQNGVS
ILIELEQDGNPDLIINYLLQKTHLQIHYSYNSVAICDNSPKLLSIKEMIFYYLEHLRKIK
LAEFNFELYKNKKRLEIITGFLKVADITDEVIKVIRASDNSKVGVVNDLIKFFNFSQTQA
EAIASMRLYRLSKIEQQIYLEESKNLEKNITKFKKLIENKDEFDKNLINMLTDFKKHHGK
PRKTRIIDSDIKIKINKDELVKDEFFYFWITKSGLYKKLDIKNSLPDEIEKTQLPNGDFF
IFQGIINQKQKAVFLTNKGEIAILAVHQIPELNLKNSPNNLKITLGIPNNQQILSVFFAD
SFESSQFLIFISKFSFAKRMNLDQLMKIKQKKLQNIFRFKEGDELISVFLEEKLKNIVLI
TTQNRALKMSISEIPIYTRNSTGIKIFRHRKNEFISASQTIESSESLAVIDFNSQFEKIN
TENLFFGNKILTPKNFKTKLDFSLSPKSIIIYNENLQIFEFGEGLKIFSLNDFRKLKTNQ
KKDYKFFLPNIQSGKNHIKNNNFLLKSNSNDQNSISKNDSTLEEKLRKVSEIDIDLILKK
IEKDDK
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagtcttgattcagtaattaattcccagctagaaaaaattttagcagaaaaa
tttatccgttattcaaaatatgtaattcaacaacgggcaattccagatgtcaaagacggc
ctaaaaccggttcagaggcgaattctttattcaatgtgacagttggggctaaaaaatagt
aaaaattacaaaaaatctgctagagttgtcggtgatgtaatcggaaaatatcatcctcat
ggtgattcttcaatctatgatgctcttgtcagacttgcccaggaatgaaaaatgaattct
ccgcttgtggaaatgcacggaaataaagggtcaattgatgacgatccacctgccgcgatg
cgatatacagaggttagattggctgaaattagtgagcatttacttgaattaatttcgaaa
aatgttgtaagtttttgccctaattttgatgatagtgaaaaagaaccaacaattttacct
gcaattttcccaaatttattaataaatggggcaattggaattgcaagtggatttgcaact
gaaatccccccgcataatttaggcgaagtgatcgatgcagcaattttgatgattaaaaat
ccaggaattacaattgaagaaatttctactataattttaggtcctgattttccaacaggc
ggaattgtttatggaaaatcaggtatttttgatgctttcaaaactggaaaaggcaaaata
aaaataagctctgattataaaattttcgaaaaaaatgggcaaaatgtaattgaaattacc
tcgattccttttggaatttcaaagtcaagtttaatcgaagaaattgatgacattcgtttt
gatgtaaaaatttatgggattaaaaatgtaattgatcaatccgatcaaaatggagtttcc
attttgatcgaactcgaacaggacggaaatcctgacctaattattaattatctactacaa
aaaactcatctacaaatacattattcttataattccgttgcaatttgtgataattcacca
aaacttttgtcaatcaaggagatgattttttactatcttgagcatttaagaaaaattaag
cttgccgaatttaattttgaactttacaaaaataaaaaaagattagaaattattactggg
tttctcaaagttgccgatattactgacgaagttattaaggttattcgcgcatctgataat
tcaaaagttggggtagttaatgatttaattaaattttttaactttagccaaacccaagca
gaggcaattgcatcaatgcgtttataccgtctttcgaaaattgagcagcaaatttacctt
gaagaatcaaaaaatttagaaaaaaacattactaagttcaaaaaacttattgaaaataaa
gatgaatttgataaaaatttaataaatatgttaactgattttaaaaaacatcacggaaaa
ccgcgaaaaactaggataattgactctgatattaagataaaaattaacaaagatgaatta
gtaaaagatgagtttttttatttttgaataacaaaatcgggactttataaaaaattagat
ataaaaaattctctccctgatgaaatagaaaaaactcagcttccaaatggagattttttc
atttttcaaggtataattaaccaaaaacaaaaagcagtttttctaactaataaaggggaa
atagcaattttagctgtgcatcaaattcctgaattaaatctgaaaaactcacctaataat
ttaaaaataactttaggaatcccaaataatcaacaaattttaagtgttttttttgctgat
agttttgaaagtagtcaatttttaatttttatttccaaattcagttttgctaaaagaatg
aatttggaccaattaatgaaaattaagcaaaaaaaattacaaaatatctttcgattcaag
gaaggtgatgagctaattagtgtttttttagaagaaaaattaaaaaatattgttctaatt
accacacaaaaccgcgctctaaaaatgagtatatcagaaattccaatttatactagaaat
tccacaggtataaaaattttcagacaccgaaaaaatgaatttatcagtgccagtcaaact
attgaaagctcagaatcacttgcagttattgactttaattcacagtttgaaaaaattaat
actgaaaatttgttttttggaaataaaattcttactccaaaaaactttaaaacaaagctt
gatttttccctgagcccaaaaagcataataatttataacgaaaatttgcaaatttttgaa
tttggagaaggattaaaaatttttagtttaaatgattttagaaagctaaaaactaatcaa
aaaaaagattataaattctttttaccaaatattcaatcgggaaaaaaccacataaaaaac
aacaactttttgctaaaaagcaattctaatgatcaaaattctatatcaaaaaatgactca
actttagaagaaaaacttcggaaagtaagtgaaattgatattgatttaattctgaaaaaa
atagaaaaggatgacaaataa

DBGET integrated database retrieval system