KEGG   Mycoplasma hyopneumoniae J: MHJ_0099Help
Entry
MHJ_0099          CDS       T00260                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
mhj00010  Glycolysis / Gluconeogenesis
mhj00051  Fructose and mannose metabolism
mhj00562  Inositol phosphate metabolism
mhj01100  Metabolic pathways
mhj01110  Biosynthesis of secondary metabolites
mhj01120  Microbial metabolism in diverse environments
mhj01130  Biosynthesis of antibiotics
mhj01200  Carbon metabolism
mhj01230  Biosynthesis of amino acids
Module
mhj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mhj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHJ_0099 (tpiA)
   00051 Fructose and mannose metabolism
    MHJ_0099 (tpiA)
   00562 Inositol phosphate metabolism
    MHJ_0099 (tpiA)
Enzymes [BR:mhj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MHJ_0099 (tpiA)
Exosome [BR:mhj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MHJ_0099 (tpiA)
  Exosomal proteins of bladder cancer cells
   MHJ_0099 (tpiA)
  Exosomal proteins of melanoma cells
   MHJ_0099 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAZ44193
LNCC_Brazil: MHJ0099
UniProt: Q4AAM8
Position
131706..132434
Genome map
AA seq 242 aa AA seqDB search
MKKIIIGNWKMNKTVSETRDFIQKFDIFYQENVGKIKEDLDFAIAPSFISLSLISKSLTK
KLEIAAQNLSQFDSGAFTGEISGKMLQDLGTKYVIIGHSERREIFKEKDEELKNKILQAQ
KYDLIPVFCVGESLLEFEAGLTKKVIISQINAIKSVLNFQKAIIAYEPIWAIGTGKTATA
AIAEKVCGLIKENFGKNTMVIYGGSVNSKNINELVSQKSIDGALVGGASLDPEEFGKILV
NS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattattggaaattgaaaaatgaataaaaccgtaagtgaaacacgtgat
tttattcaaaaatttgacattttctatcaggaaaatgtgggcaaaatcaaagaagattta
gattttgcaatagctccaagttttatatctttatcactaatttctaagtccttgactaaa
aaattagaaattgctgctcaaaatcttagtcagtttgattcaggagcctttactggggaa
atcagtggcaaaatgctgcaggatttagggacaaaatatgtaattattgggcattctgaa
agaagagaaatttttaaagaaaaagatgaagaactaaaaaataaaattttacaagcacaa
aaatatgatttaattcctgttttttgtgttggtgaaagtcttttagaatttgaagccggc
ctaactaaaaaagtgataatttcgcagataaatgctataaaatcagttctaaattttcaa
aaggcaattattgcatatgaaccaatttgggccattggaactggcaaaacagcaacggct
gcaatagcagaaaaagtttgtggactgattaaggaaaattttgggaaaaatacaatggta
atttatggaggctctgttaattctaagaatattaacgagttagtatcccagaaaagcatc
gatggcgcccttgtaggtggagcctctcttgatccagaagaatttggaaaaattttagtt
aatagttaa

DBGET integrated database retrieval system