KEGG   Mycoplasma hyopneumoniae J: MHJ_0107Help
Entry
MHJ_0107          CDS       T00260                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHJ_0107 (pfkA)
   01230 Biosynthesis of amino acids
    MHJ_0107 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHJ_0107 (pfkA)
   00030 Pentose phosphate pathway
    MHJ_0107 (pfkA)
   00051 Fructose and mannose metabolism
    MHJ_0107 (pfkA)
   00052 Galactose metabolism
    MHJ_0107 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MHJ_0107 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MHJ_0107 (pfkA)
Enzymes [BR:mhj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHJ_0107 (pfkA)
Protein phosphatases and associated proteins [BR:mhj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHJ_0107 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(146026..146994)
Genome map
AA seq 322 aa AA seqDB search
MSKKIGILTSGGDAPGMNSAISFLAKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNG
ISSFGGTAIGSSRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKV
IALPGTIDNDIQFTDYTIGFDTALNTIVETIDKLRDTANSHRRCFVVEVMGRHCQDLALY
SAMATGSEILITNTNILTPEEVSQKVLEQFAKGKPSVIVTITENILPNLKEFAAKIEELT
KISTRSLEVGHTQRGGRPSAFDRILAAKMAMKAMELINQDKSGLAISYLDGKIQTFDIAK
VVSKPVRKTNDLVLEINKINQN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaatcggtatattaacttcaggcggcgatgcgcctgggatgaattctgca
ataagttttttggcaaaatcagcacttagtttaggttttgagccatatttaatttttgat
ggctattctggaataatcgcaagaaaaatattgccagcaaaaaattttccttataatgga
atttctagttttggcggaactgccataggatcaagtcgctttcctgaatttaaaaaagag
gaagttcaaaataaagccgttgaaattttaagtgaaattgggattagttcgcttgtggta
gttggtggcgatggaacctataatggcggttataaattacatttaaaaggaataaaagta
atcgctttaccaggaaccattgataatgatatccagtttaccgattatacaattggattt
gatactgctttgaatacgatagttgaaactattgataaattaagggatacggcgaattct
catcgtcgttgttttgtagttgaagttatggggagacattgtcaagatttagctttatat
tcggcaatggcaactggaagcgaaattttaattactaatacaaatattttaacccctgaa
gaggtaagtcaaaaagttttagaacagtttgcaaaaggcaaaccaagcgtgatagtaaca
attacagagaatattttaccaaacctaaaagagtttgcggctaaaattgaggagttaaca
aaaatttccactcgctctttagaagttggacatacccagcgcggcggcaggccttcagct
tttgaccgaattttagcagccaagatggcaatgaaagctatggaattaattaatcaagat
aaatcaggtcttgcaattagttatttagatggtaaaatccaaacttttgatattgcgaaa
gtagtatcaaaacctgttagaaaaacaaacgacttagtgcttgaaattaataaaatcaat
caaaattaa

DBGET integrated database retrieval system