KEGG   Mycoplasma hyopneumoniae J: MHJ_0149Help
Entry
MHJ_0149          CDS       T00260                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MHJ_0149 (gmk)
Enzymes [BR:mhj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MHJ_0149 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(185492..186085)
Genome map
AA seq 197 aa AA seqDB search
MKVKMSKLIILSGPSGVGKGTIESLLLKNKNLLIKLAISATTREKRRDEINGVNYFFLTV
QEFKEKIENDEFIEWSCHFNNYYGTLKSQIKFIQSQNFIPLLEIDTTGAKNIIENYKNKG
ELSQLLTIFILPPSIESLKNRIQKRLTETNIQINQRLEKAKAEIKIKNLFKFQVVNDNLE
ECVAQIEKIISKEIQKT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaaatgagtaaattaataattttgtctggaccttcaggggttggcaagggc
acaattgaatcacttttattaaaaaataaaaatttattaataaagttagcaatttctgca
acaactcgagaaaaaaggagagacgaaattaacggagttaattattttttcctaacagtt
caagagtttaaagaaaaaattgaaaatgatgaatttattgaatgaagttgtcattttaat
aattattatgggaccctaaaatcgcagattaagtttattcagtctcaaaattttatccca
ttattggaaattgatacaacaggtgctaaaaatattattgaaaattacaaaaataaaggt
gaattatcccaacttttaactatttttatcctccctccttccattgaatctcttaaaaac
cggattcaaaaacgtctaacagaaacaaatattcaaataaatcaacgactagaaaaagcc
aaagctgagattaaaattaaaaatttgttcaaatttcaagtggttaatgacaatttagaa
gaatgtgttgcccaaatagaaaaaattataagtaaagagatccaaaaaacttag

DBGET integrated database retrieval system