KEGG   Mycoplasma hyopneumoniae J: MHJ_0250Help
Entry
MHJ_0250          CDS       T00260                                 

Gene name
recR
Definition
(GenBank) recombination protein
  KO
K06187  recombination protein RecR
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
mhj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHJ_0250 (recR)
DNA repair and recombination proteins [BR:mhj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MHJ_0250 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MHJ_0250 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 HHH_5 zn-ribbon_14 YbaJ HHH
Motif
Other DBs
NCBI-ProteinID: AAZ44341
LNCC_Brazil: MHJ0250
UniProt: Q4AA80
Position
298970..299554
Genome map
AA seq 194 aa AA seqDB search
MIKETFKNLAEDLRKIPGISKKQAMRILSFLVDVPIEKIENFVRAIYDLKKNTQYCEKCG
YLNTNPVCEICLDFQRSFKILVVENTEMIAKFEEYGKYDGQYFVFGKYDIKNLENHNAQI
KKLADLAANKSEIILGLSSTMEGLIFANYLAKHEFLSGLKITRLATGIPFGAIIDYIDNI
TLDQALKNRQEMEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagaaacatttaaaaatcttgctgaggatctaagaaaaatcccgggaatttcc
aaaaaacaagcaatgcgaattttgtcttttttggttgatgttccaattgaaaaaattgaa
aattttgttagagcaatttatgatttaaaaaaaaacacacaatattgtgaaaaatgtggg
tatttaaatactaatccagtttgtgaaatatgccttgatttccaacggtcttttaaaatt
ttagtagttgaaaataccgaaatgattgctaaatttgaagaatatggaaaatatgatggt
caatattttgtttttggtaaatatgatattaaaaatttagaaaatcataatgcccaaatt
aaaaaattagctgatttagccgctaataaaagtgagataattcttggtttatcttcgaca
atggagggactgatttttgcaaattatctcgcaaaacacgagtttttatccggccttaaa
attactcggcttgcaactggaattccatttggagcaataattgattatatcgataatatc
accttagatcaagcgcttaaaaatcgacaagaaatggaaaaataa

DBGET integrated database retrieval system