KEGG   Mycoplasma hyopneumoniae J: MHJ_0250Help
Entry
MHJ_0250          CDS       T00260                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mhj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
298970..299554
Genome map
AA seq 194 aa AA seqDB search
MIKETFKNLAEDLRKIPGISKKQAMRILSFLVDVPIEKIENFVRAIYDLKKNTQYCEKCG
YLNTNPVCEICLDFQRSFKILVVENTEMIAKFEEYGKYDGQYFVFGKYDIKNLENHNAQI
KKLADLAANKSEIILGLSSTMEGLIFANYLAKHEFLSGLKITRLATGIPFGAIIDYIDNI
TLDQALKNRQEMEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagaaacatttaaaaatcttgctgaggatctaagaaaaatcccgggaatttcc
aaaaaacaagcaatgcgaattttgtcttttttggttgatgttccaattgaaaaaattgaa
aattttgttagagcaatttatgatttaaaaaaaaacacacaatattgtgaaaaatgtggg
tatttaaatactaatccagtttgtgaaatatgccttgatttccaacggtcttttaaaatt
ttagtagttgaaaataccgaaatgattgctaaatttgaagaatatggaaaatatgatggt
caatattttgtttttggtaaatatgatattaaaaatttagaaaatcataatgcccaaatt
aaaaaattagctgatttagccgctaataaaagtgagataattcttggtttatcttcgaca
atggagggactgatttttgcaaattatctcgcaaaacacgagtttttatccggccttaaa
attactcggcttgcaactggaattccatttggagcaataattgattatatcgataatatc
accttagatcaagcgcttaaaaatcgacaagaaatggaaaaataa

DBGET integrated database retrieval system