KEGG   Mycoplasma hyopneumoniae J: MHJ_0503Help
Entry
MHJ_0503          CDS       T00260                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mhj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mhj00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mhj00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mhj00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
648264..649184
Genome map
AA seq 306 aa AA seqDB search
MSKILATPKARAMAKHANIDLADLKIQHRKIEASDVENYIKSLKSAQTSAEKVEVSSSQQ
AEKTSIPASIPPKLEGKREKIAPIRKAIARAMTNSWNSVAYVNLVNQIDVSDLWKLRKSV
LDPVLKTSGVKLTFLAFIAKAILIALSEFPVMAAKYDEATSEIVYPDTLNLGLAVDTDAG
LMVPVIKDAQKLSIVEIAKEIVRLAKAARERKIKPSEMQGGSFTITNYGSVGSLYGVPVI
NYPELAIAGVGAIIDSAEVKDGQIVASKIMHLTVAADHRWIDGATIGRFAARVKELLEKP
EILGIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattttagcaaccccaaaagcaagagcgatggcaaaacatgctaatattgat
cttgctgatcttaaaattcaacatcggaaaattgaagcttccgatgttgaaaattacata
aaatccttaaaatcagcacaaactagtgctgaaaaagtagaagtttcatcgtctcagcag
gctgaaaaaacttctattcccgcgtcaattccgcctaaattagaaggaaaacgcgagaaa
atcgctccaattcgaaaagcaattgcaagagcgatgactaattcttgaaattcagttgcc
tatgtcaacctcgttaatcaaattgacgttagcgatctttgaaaacttagaaaatcagtt
ttagaccctgtcctaaaaacatcaggtgtgaaactaacatttcttgcttttattgccaaa
gccattttgattgctcttagtgaatttcctgttatggcagcaaaatatgatgaagcaaca
agtgaaattgtctatcctgatactttaaatttaggtcttgctgtcgatactgacgccggg
cttatggttccagtaattaaggatgctcaaaagctttcaattgtagaaattgcaaaagaa
attgttcgtcttgccaaagctgcccgtgaacgtaaaattaaaccaagcgaaatgcaaggt
ggatcatttacaatcacaaattatggatcggttggttcactttatggtgttccagtaata
aattatcctgaactggcaattgctggagtaggagctattattgattcagccgaggtcaag
gatggtcaaattgttgcttcaaaaattatgcatttaacagttgctgcagatcatcgttga
attgatggtgcaacaattggtcgttttgctgcaagagttaaagaattattagaaaaacca
gaaattttaggaatcttataa

DBGET integrated database retrieval system