KEGG   Mycoplasma hyopneumoniae J: MHJ_0515Help
Entry
MHJ_0515          CDS       T00260                                 

Gene name
glck
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHJ_0515 (glck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHJ_0515 (glck)
   00052 Galactose metabolism
    MHJ_0515 (glck)
   00500 Starch and sucrose metabolism
    MHJ_0515 (glck)
   00520 Amino sugar and nucleotide sugar metabolism
    MHJ_0515 (glck)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MHJ_0515 (glck)
   00524 Butirosin and neomycin biosynthesis
    MHJ_0515 (glck)
Enzymes [BR:mhj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MHJ_0515 (glck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
661466..662335
Genome map
AA seq 289 aa AA seqDB search
MDIGGTNTRFAIFSDNKITKKIKFATDVINYKKILDKILDLVSQYKINAIALCIPGPADY
QKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNTKKGVTQFY
TISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFISGTGMSLRA
KDKNLEQTEPKNIIALSQEDKGYRQIVGDCIDTLARTISITIGILNPNLMVFGGSIAEYN
FWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atcgacatcggcggaacaaatacacgttttgcaatttttagtgataataaaatcacaaaa
aaaattaaatttgccactgatgttataaattataaaaaaattcttgataaaattcttgat
ctagttagccaatacaagattaacgcaatcgccttgtgcatccctggtccggctgattat
caaaaagggattattctctcttcgcctaatttaataggctgaaatggaataaatattaag
gaatatctcctaaataattctaaattagaatatgctatctttgaaaatgatgcaaatgca
atggcatttgccaatcatattttttataaaaataccaaaaaaggcgtaactcagttttat
acaatctcaactggttttggtgctggactcgtaattaataataaaatttttcatggtgct
aatggttttggacaggaaattgcacatattccaacctcaaaaatatttaataaaaagcat
catctaaataattatgcagctgaattatttatctcgggaacaggaatgtctttaagagct
aaagataaaaacttagaacaaaccgaaccaaaaaatattatcgcactatctcaagaagat
aaaggctacagacaaattgttggcgactgtattgataccttggcgcgaacaatttcgata
acaattggaattttaaatcctaatttgatggtttttggcggttctatagctgagtataat
ttttgaataattcaaaaagcgatcaaaaaagcgaaacagtgaacaaataaagaccaatga
gaagctataaagtttgaaaaagatccttttggtgatgattcggctttatttgggctttac
tacctaatattagaaaaaacaaagaaataa

DBGET integrated database retrieval system