KEGG   Candidatus Mycoplasma haemolamae: MHLP_00310Help
Entry
MHLP_00310        CDS       T02329                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mhl  Candidatus Mycoplasma haemolamae
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MHLP_00310
Enzymes [BR:mhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MHLP_00310
Exosome [BR:mhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MHLP_00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67393..68850
Genome map
AA seq 485 aa AA seqDB search
MTREKISLALDLGSSAFKLLLYSSKRGQILCTEHPFSTTYEEGGRVEHNPEELWPLIYRE
LDNLLSSLPKEDAPSTLGISTQRESVVIWEKDTGKELSSIVSWQDTRTDSLLEDFSREQQ
ELIWSRTGLKLSSYCSAIKFSYLLKNLALPSNYLLGTLDSWLAYKLSKGRYFVTDYTSAS
RTALFNLETLKWDGEICSLFGVDPSSLPNLVENNQEIGEIEIGSHSLTLQGLIGDQQSSL
YSVYRNNAQRPSMGGREKSLAALTYGTGVFLLRLLPEDTNFKEIISKSSYEGPLIVTIAW
KNKDEGVRFALELSLSNCGQALNWISRTLDIDLQTPLVKERRNLPYCFPFFSGRWFLSEN
RHLKSGFLGLNLETTKSEVLTSFYEGLAFSIRKGLELVGIDYSSCLSVGGGMTRSQEFLE
LQSSYLGTSLSRDCSMHMSALGASLLSIVDEVGKNTEEVISPKRDLEAYISCRYKNWLNY
LDSLN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgactagggaaaagatctctctagccttagatttaggttctagtgcctttaaactactc
ctctattcctctaaaagaggtcagatactctgtacagaacaccctttctctactacctat
gaagaaggagggagggtagagcacaatcctgaagagctgtgacctttaatctacagagaa
ctcgataatcttctctcttctctacctaaagaagatgcaccaagtacattaggtatatct
acccaacgagagagtgttgtcatctgagagaaagacacaggcaaagagctgagttcgatt
gtctcttgacaagacactaggactgactccctcctagaggacttctctagagagcaacag
gaacttatttgatcgagaacaggactgaagctttcctcatattgttcagctattaagttc
tcttatctacttaagaatctagcactcccttctaactatcttttaggcaccttagacagt
tgattagcttacaaactatcgaaaggtaggtactttgtcactgactatacctcagcgtct
agaacagccttatttaatctagagacacttaaatgagatggtgagatttgctccctcttt
ggagtagatccttctagcttacctaacttagtagagaacaatcaagagattggagagata
gaaataggtagtcattctttaactcttcagggattaataggagatcaacaaagctctttg
tattccgtttatagaaataatgcgcagcggccaagcatgggcgggcgggagaagagcttg
gctgctctaacctacggaacaggagttttccttttacgtcttttaccagaggacactaac
ttcaaggagattatttccaagtcttcctatgaaggtcctctaatagttactattgcctga
aaaaacaaagacgaaggtgttaggtttgcgctagaacttagcctttctaattgtggtcaa
gcgctcaattgaatctctaggacactagatatagacttacaaactcctttagttaaggag
agaaggaacttaccctattgttttcccttcttttctgggcggtgattcctatctgaaaac
agacaccttaaatcaggatttttaggacttaaccttgaaaccactaagtcagaggtactt
acctccttctatgagggactagccttctccattaggaagggactagagttagtgggcatt
gactactcttcctgtttaagtgttggaggaggaatgactagaagtcaagagtttctggag
ctacagtcttcttatttaggtacttctctgtctagagactgttcgatgcacatgagtgct
ttaggggcttctcttctctctatagttgacgaggtaggaaaaaatactgaagaggtaatt
tcccctaaacgggatttagaggcctatataagctgtagatataagaattgattaaattac
ctagatagtctcaattag

DBGET integrated database retrieval system