KEGG   Candidatus Mycoplasma haemolamae: MHLP_00510Help
Entry
MHLP_00510        CDS       T02329                                 

Gene name
gltX
Definition
glutamyl-tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mhl  Candidatus Mycoplasma haemolamae
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MHLP_00510 (gltX)
Enzymes [BR:mhl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     MHLP_00510 (gltX)
Amino acid related enzymes [BR:mhl01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   MHLP_00510 (gltX)
Transfer RNA biogenesis [BR:mhl03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MHLP_00510 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97737..99200
Genome map
AA seq 487 aa AA seqDB search
MGNFNRTRTRFAPSPTGSLHLGGLRTALINYLFAKQNNGDFILRIEDTDTSRNQEDQVRK
ILDDLESLRLIPDESFACPGEYGPYLQSQRLDKYTARAKELIEKGKAYRCFCTQEELDKE
REEDNQYIYSGKCRYLKEKEVADNLAAKKLFSVRLKVEKNKTYSWKDYVRGEMSIPSSAL
GDIILIRSNGIPMYNFAAAVDDYEMKISDIFRGEEHLSNTPYQLALYKAFGWEEFIPSYG
HLSLIASESGRKISKRDPDSYKYYVNYFLERGFYPEALLNYLLILGWTEGEREFFTVKEA
ISAFKTETLSGSPSIFDFKKLEWMSQSYLNKLDLLQYLNFVLPFFKSEHEEFTAYPEKRR
DFAVCFRSRVKYASFLEDLAEEFYSLEYLKKEGLDSLKSFESSITLIDTALTRLKERGPD
NFVEIEIRLFLKQLLVKLELPRPDVFKNLRLALIGEKEGLPLHSVIYLLGYSRTLERLEK
VKNLLGQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgggcaatttcaatcgaaccagaactaggtttgctccttccccaacagggtcactccac
ctaggaggactaagaacagccttaattaactatttatttgccaagcaaaacaacggagac
ttcatcttaaggatagaagatacagatacctctaggaatcaagaagaccaggtaagaaag
attcttgatgatcttgaatcactgagactgattcctgacgaatcttttgcctgcccagga
gagtatggtccttacttgcagtctcagaggttggacaagtacaccgctagagctaaagag
ttaatagaaaaaggcaaagcatataggtgtttttgtacccaagaagaactagacaaagaa
agggaagaagacaatcagtacatctattcaggtaagtgtaggtaccttaaggagaaggag
gtagcggacaacctagctgctaagaagctttttagcgttcgactgaaggtagagaagaac
aaaacatacagctgaaaagactatgttaggggggagatgtctattccctcctcagcttta
ggagacatcatcctgattaggagtaacggaatacctatgtacaactttgctgcagcagtc
gatgattatgagatgaaaatcagtgacatctttagaggagaagaacacctttccaatact
ccctaccagttggctctatataaggcttttggttgagaagagttcattccttcttatggt
catctttctctgatagcttcagaatcaggaagaaagatctctaagagggaccctgattcc
tataagtattatgtcaactactttttggaaagaggcttctaccctgaagctttattgaat
tatctactcatattgggctgaacagaaggagaaagagagttctttacagttaaggaggca
attagtgcttttaaaacagagacattaagcggctctccttcgatctttgacttcaagaag
ttagagtgaatgagtcagtcttacctcaataagttagaccttttacagtacctgaacttt
gttctgcccttcttcaagagcgaacatgaggaatttactgcctatcctgaaaagagaaga
gactttgccgtctgctttaggtcgagagttaagtatgcttccttcctggaagaccttgct
gaagaattctactctctggaatatctaaagaaagaaggactagactctcttaagtctttt
gagtcgtccattacattaatagatacagctcttactcgcctaaaagagaggggtccagat
aacttcgtagagatagagataagactcttcctaaagcagttactggttaaattggagtta
cctagacctgatgtctttaagaatttaagactagcattaataggagaaaaagaaggacta
ccccttcactctgttatctatctcttaggttattcaaggactcttgaacgattggaaaag
gtaaagaacctacttggtcaataa

DBGET integrated database retrieval system