KEGG   Candidatus Mycoplasma haemolamae: MHLP_03435Help
Entry
MHLP_03435        CDS       T02329                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhl  Candidatus Mycoplasma haemolamae
Pathway
mhl00010  Glycolysis / Gluconeogenesis
mhl00030  Pentose phosphate pathway
mhl00051  Fructose and mannose metabolism
mhl00680  Methane metabolism
mhl01100  Metabolic pathways
mhl01110  Biosynthesis of secondary metabolites
mhl01120  Microbial metabolism in diverse environments
mhl01130  Biosynthesis of antibiotics
mhl01200  Carbon metabolism
mhl01230  Biosynthesis of amino acids
mhl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHLP_03435
   00030 Pentose phosphate pathway
    MHLP_03435
   00051 Fructose and mannose metabolism
    MHLP_03435
   00052 Galactose metabolism
    MHLP_03435
  Energy metabolism
   00680 Methane metabolism
    MHLP_03435
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MHLP_03435
Enzymes [BR:mhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHLP_03435
Protein phosphatases and associated proteins [BR:mhl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHLP_03435
Messenger RNA biogenesis [BR:mhl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MHLP_03435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PucR
Motif
Other DBs
NCBI-ProteinID: AFO52267
UniProt: I7C6U9
Position
complement(554289..555272)
Genome map
AA seq 327 aa AA seqDB search
MRKVAILTSGGDSPGMNSAIYSFSSLAQKKGYEVVFIEDGYQGLIEKRYRKVNASCLKKA
VYAPGTHIGSSRSLDFKNDQELREEGVKALKDQGVEALVVLGGNGSYQGGELISKLGLPV
ILLPATIDNDVNSTVYTIGFFSALEEIGQVIQKIWYTANSHSQLTFVEVMGRDCSDLGVF
ASISSPFVEMVITQEKVPTVQELESKIRELKTQGRKGMVIVVVEKVLGSQTLPPLPELTK
TLESNLGITVRGCVLGHTQRGAIPTTFERFVAEGFGRTAFECFESRELDLAIGFDGQKFY
KTPLSSLSHSSKGSKLDLIEYKNSLAF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaggtagcgatactcacttcagggggtgattcccctggaatgaattctgctatc
tatagctttagtagtctagctcaaaagaaaggttatgaagtcgtatttatcgaagacggt
tatcaaggactcatagagaagagatatagaaaggtaaatgctagttgcctaaagaaggct
gtatatgctcccggaactcacataggttctagtagatctttggacttcaaaaatgaccaa
gagttacgagaagaaggcgttaaagctttaaaggatcaaggagtagaagctttggtagta
ttgggcggtaacggctcctatcagggaggagaattaatctcaaaattaggattacctgtc
attctcttacccgcaactatagacaatgatgtaaactcgacagtttacactataggcttc
ttttcagctctagaggagataggtcaggtaatacaaaagatctgatacacagctaattct
cactctcaacttacctttgtggaggtaatgggaagggattgctccgatctaggtgtcttt
gcttcaatctcttctccctttgttgagatggttattacccaagagaaggtacctactgtc
caagagttagagtcgaagataagggaattaaagactcaaggaaggaaaggaatggttatt
gtagttgttgagaaggtattaggttcacaaacgctccctcccctaccagaattaacaaag
accttagagtctaatctgggaataaccgttaggggatgtgtattgggccacactcagaga
ggagctatacctactacttttgagagatttgttgctgaaggctttggtagaacagcgttc
gagtgctttgagtctagagaattagatcttgctatcggttttgatggccaaaaattttac
aagacaccactgtctagtttgagccactcttctaaaggcagtaaactagatttaattgaa
tacaaaaacagcttagctttttag

DBGET integrated database retrieval system