KEGG   Candidatus Mycoplasma haemolamae: MHLP_03435Help
Entry
MHLP_03435        CDS       T02329                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhl  Candidatus Mycoplasma haemolamae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHLP_03435
   01230 Biosynthesis of amino acids
    MHLP_03435
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHLP_03435
   00030 Pentose phosphate pathway
    MHLP_03435
   00051 Fructose and mannose metabolism
    MHLP_03435
   00052 Galactose metabolism
    MHLP_03435
  Energy metabolism
   00680 Methane metabolism
    MHLP_03435
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MHLP_03435
Enzymes [BR:mhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHLP_03435
Protein phosphatases and associated proteins [BR:mhl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHLP_03435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554289..555272)
Genome map
AA seq 327 aa AA seqDB search
MRKVAILTSGGDSPGMNSAIYSFSSLAQKKGYEVVFIEDGYQGLIEKRYRKVNASCLKKA
VYAPGTHIGSSRSLDFKNDQELREEGVKALKDQGVEALVVLGGNGSYQGGELISKLGLPV
ILLPATIDNDVNSTVYTIGFFSALEEIGQVIQKIWYTANSHSQLTFVEVMGRDCSDLGVF
ASISSPFVEMVITQEKVPTVQELESKIRELKTQGRKGMVIVVVEKVLGSQTLPPLPELTK
TLESNLGITVRGCVLGHTQRGAIPTTFERFVAEGFGRTAFECFESRELDLAIGFDGQKFY
KTPLSSLSHSSKGSKLDLIEYKNSLAF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaggtagcgatactcacttcagggggtgattcccctggaatgaattctgctatc
tatagctttagtagtctagctcaaaagaaaggttatgaagtcgtatttatcgaagacggt
tatcaaggactcatagagaagagatatagaaaggtaaatgctagttgcctaaagaaggct
gtatatgctcccggaactcacataggttctagtagatctttggacttcaaaaatgaccaa
gagttacgagaagaaggcgttaaagctttaaaggatcaaggagtagaagctttggtagta
ttgggcggtaacggctcctatcagggaggagaattaatctcaaaattaggattacctgtc
attctcttacccgcaactatagacaatgatgtaaactcgacagtttacactataggcttc
ttttcagctctagaggagataggtcaggtaatacaaaagatctgatacacagctaattct
cactctcaacttacctttgtggaggtaatgggaagggattgctccgatctaggtgtcttt
gcttcaatctcttctccctttgttgagatggttattacccaagagaaggtacctactgtc
caagagttagagtcgaagataagggaattaaagactcaaggaaggaaaggaatggttatt
gtagttgttgagaaggtattaggttcacaaacgctccctcccctaccagaattaacaaag
accttagagtctaatctgggaataaccgttaggggatgtgtattgggccacactcagaga
ggagctatacctactacttttgagagatttgttgctgaaggctttggtagaacagcgttc
gagtgctttgagtctagagaattagatcttgctatcggttttgatggccaaaaattttac
aagacaccactgtctagtttgagccactcttctaaaggcagtaaactagatttaattgaa
tacaaaaacagcttagctttttag

DBGET integrated database retrieval system