KEGG   Mycoplasma hyorhinis MCLD: SRH_00615Help
Entry
SRH_00615         CDS       T01945                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhm  Mycoplasma hyorhinis MCLD
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mhm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137622..138263
Genome map
AA seq 213 aa AA seqDB search
MEIYKFGKIVSKSKNYLILEQNYVGHLIYVPNIDRFEKDESKKIYIYKYENEYSKTTYGF
ENFRERILFEDLISVQGIGPKTAIAILNQGWETAMSYIADGDWKKISEFPYLNVKNAKQI
VFEFQNKYIKIFQNYQKTLNKDKVINVEEEVTFSSKTVLEDKIAKELEDTLKILGFQKKQ
INYALSKVQANNDFELLVEEAIKLISNAREFRN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttataaatttggaaaaatagtatccaaaagtaaaaattatttaattttagaa
caaaattatgtaggtcatttaatttatgtgcctaacatagatagatttgaaaaagatgaa
agtaaaaaaatatatatttataaatatgaaaatgaatattcaaaaacaacatatggtttt
gaaaactttagagaacgtattttatttgaagatttaatttcagttcaaggtatcggacct
aaaactgcaattgctatactaaatcaaggttgagaaactgcaatgtcatatatagctgat
ggagactggaaaaaaattagtgaatttccatatttaaatgtcaaaaatgcaaagcaaatt
gtcttcgaatttcagaataaatatatcaaaatcttccaaaactatcaaaaaactttaaac
aaagacaaagtaattaacgttgaagaagaagttacctttagctcaaaaactgttttagaa
gataaaatagcaaaagaacttgaagatacactaaaaatccttggatttcaaaagaaacag
attaattatgcgctttctaaagttcaagctaacaatgactttgaacttttagtggaagaa
gcaattaagttgatttcaaatgcaagagaatttagaaattag

DBGET integrated database retrieval system