KEGG   Mycoplasma hyorhinis MCLD: SRH_01175Help
Entry
SRH_01175         CDS       T01945                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhm  Mycoplasma hyorhinis MCLD
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRH_01175
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRH_01175
   00052 Galactose metabolism
    SRH_01175
   00500 Starch and sucrose metabolism
    SRH_01175
   00520 Amino sugar and nucleotide sugar metabolism
    SRH_01175
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SRH_01175
   00524 Butirosin and neomycin biosynthesis
    SRH_01175
Enzymes [BR:mhm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SRH_01175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(253683..254576)
Genome map
AA seq 297 aa AA seqDB search
MKKYNFATIDIGGTNTRFAIFDQDKIVKKIRFTTDVNNYKKVLDKILDLVDQYKINAIAL
CIPGPADYSKGIILSSPNLVGWNGINIKDYLLNNSQLEYAIFENDANAMAFANHIHFKNN
KKGVTQFYTISTGFGAGLVINNKIFHGAKGFAQEIAHIPTSKTFNRKHHLNNYAAELFAS
GTGMSLRAQDKNLEFVDAKSIIANYDKNQNYREIVDDCIDTIARTIATTIGMLNPNLIVF
GGSVAEYNYWIIEKAIKKAKLWTNQDQWNCVEFKKDVFGDDSALFGLYYLIVEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataattttgcaactattgatattggaggtacaaatactcgttttgctatt
tttgatcaagacaagattgttaaaaaaattagatttacaactgatgttaataattacaaa
aaagtattggataaaattttagatttggttgatcaatacaaaattaacgctattgctcta
tgtattccaggtccagctgattattcaaaaggaataattctttcttcacctaatttagtt
ggttgaaatggaattaatattaaagattatttactcaataactcacaattagaatacgct
atttttgaaaacgatgccaatgcaatggcttttgcaaatcatattcattttaaaaataac
aaaaaaggtgtaactcagttttacactatctcaactggatttggcgctggattagtcatt
aataacaaaatttttcatggagctaaaggatttgctcaagaaattgctcacatcccaact
tctaagacctttaatagaaaacatcatttaaataactacgcagctgaattatttgcatct
ggtacaggaatgtcactaagagctcaggataaaaatttagaatttgttgatgctaaaagt
attattgcaaattatgataaaaatcaaaattacagagaaattgtagatgattgtatcgat
acaatagcaagaacaattgctacaacaattggtatgttaaatccaaatttaattgttttt
ggtggttctgtagcagaatataattattgaatcattgaaaaagcaattaaaaaagcaaaa
ctctgaaccaatcaagatcaatgaaactgtgtagagttcaaaaaagatgtttttggtgat
gattctgctttatttggtttgtattatttaattgtggaaaaaactaaaaaataa

DBGET integrated database retrieval system