KEGG   Mycoplasma hyorhinis MCLD: SRH_01175Help
Entry
SRH_01175         CDS       T01945                                 

Definition
(RefSeq) glucokinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhm  Mycoplasma hyorhinis MCLD
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRH_01175
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRH_01175
   00052 Galactose metabolism
    SRH_01175
   00500 Starch and sucrose metabolism
    SRH_01175
   00520 Amino sugar and nucleotide sugar metabolism
    SRH_01175
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SRH_01175
   00524 Butirosin and neomycin biosynthesis
    SRH_01175
Enzymes [BR:mhm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SRH_01175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(253683..254576)
Genome map
AA seq 297 aa AA seqDB search
MKKYNFATIDIGGTNTRFAIFDQDKIVKKIRFTTDVNNYKKVLDKILDLVDQYKINAIAL
CIPGPADYSKGIILSSPNLVGWNGINIKDYLLNNSQLEYAIFENDANAMAFANHIHFKNN
KKGVTQFYTISTGFGAGLVINNKIFHGAKGFAQEIAHIPTSKTFNRKHHLNNYAAELFAS
GTGMSLRAQDKNLEFVDAKSIIANYDKNQNYREIVDDCIDTIARTIATTIGMLNPNLIVF
GGSVAEYNYWIIEKAIKKAKLWTNQDQWNCVEFKKDVFGDDSALFGLYYLIVEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataattttgcaactattgatattggaggtacaaatactcgttttgctatt
tttgatcaagacaagattgttaaaaaaattagatttacaactgatgttaataattacaaa
aaagtattggataaaattttagatttggttgatcaatacaaaattaacgctattgctcta
tgtattccaggtccagctgattattcaaaaggaataattctttcttcacctaatttagtt
ggttgaaatggaattaatattaaagattatttactcaataactcacaattagaatacgct
atttttgaaaacgatgccaatgcaatggcttttgcaaatcatattcattttaaaaataac
aaaaaaggtgtaactcagttttacactatctcaactggatttggcgctggattagtcatt
aataacaaaatttttcatggagctaaaggatttgctcaagaaattgctcacatcccaact
tctaagacctttaatagaaaacatcatttaaataactacgcagctgaattatttgcatct
ggtacaggaatgtcactaagagctcaggataaaaatttagaatttgttgatgctaaaagt
attattgcaaattatgataaaaatcaaaattacagagaaattgtagatgattgtatcgat
acaatagcaagaacaattgctacaacaattggtatgttaaatccaaatttaattgttttt
ggtggttctgtagcagaatataattattgaatcattgaaaaagcaattaaaaaagcaaaa
ctctgaaccaatcaagatcaatgaaactgtgtagagttcaaaaaagatgtttttggtgat
gattctgctttatttggtttgtattatttaattgtggaaaaaactaaaaaataa

DBGET integrated database retrieval system