KEGG   Mycoplasma hyorhinis MCLD: SRH_01225Help
Entry
SRH_01225         CDS       T01945                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhm  Mycoplasma hyorhinis MCLD
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mhm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mhm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mhm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(263091..263822)
Genome map
AA seq 243 aa AA seqDB search
MSKTIIIGNWKMNKTFTQTKEFFSAFNQLYIENKNKINQNLDFAVALPAINVAAFSKNTT
KLELAVQNMSQFEKGAYTGEISAQMLLDLNVKYAIIGHSERRQYFKETDLDVNAKTQQAI
KNNIIPVVCVGETLEEYEAQKTSQVIEYQLKNSLKDVDLSKVIVAYEPIWAIGTGKTATP
EQAQQVCKFIRKQTNKNLTILYGGSVSQENIEQLLNQADINGALVGGASLKVDSFIKLLT
LNK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactattattattggtaattgaaaaatgaataaaacttttacacaaacaaaa
gaatttttttctgcttttaatcaactatacatagaaaataaaaacaaaattaatcaaaat
ttggattttgcagttgcacttcctgcaataaatgtagctgcatttagtaaaaatacaaca
aaattagaattagcagttcaaaatatgtcacaatttgaaaaaggagcttatactggcgaa
atttctgcgcaaatgttattggatttaaatgtcaaatatgctattattggtcattcagaa
agaaggcaatattttaaagaaactgatttagatgtaaatgcaaaaacacaacaagcaatt
aaaaataatattattccagttgtttgtgtgggtgaaacattagaagaatatgaagcacaa
aaaacaagtcaagtaattgaatatcaactaaaaaattcattaaaagatgtagatttaagc
aaagttatagtggcttacgaaccaatttgagcaattggtacaggaaaaactgctacacca
gagcaagcacaacaagtttgcaaatttattagaaaacaaacaaataaaaatttaactatc
ttatatggtggctcagtttctcaagaaaatatagagcaattattaaatcaagcagatatt
aacggagcgctagttggaggagcatctttaaaagtagattcatttataaaattattaact
ttaaacaaataa

DBGET integrated database retrieval system