KEGG   Mycoplasma hyorhinis MCLD: SRH_02430Help
Entry
SRH_02430         CDS       T01945                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhm  Mycoplasma hyorhinis MCLD
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mhm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526997..527833
Genome map
AA seq 278 aa AA seqDB search
MPELPEVVTVVNQLNEKIINKKVVSVKLYKEKLLKNSTVEQLENWFVNEKILSVKNKGKF
IVFYFSNDKILISHLRLNGKYFFNNSSKKEPHNHLMIQFDDNTFLHYNDTRMFGTFHIKT
TKDYLNTTPLSNVGPTPMEISEEELFNKLQKSKRSIKPTLLDQQIVSGLGNIYVDEVLFA
CSIHPLTKAFLINKNELKLIKKFATSILLKSIELGGSTINSYSSLNMQEGNFQNFLQVHT
KKGFACSRCNNIIEKITVGGRGTYICSNCQNEKKQSKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgttacagttgttaatcaactaaatgaaaaaattatcaat
aaaaaagtagtttctgtcaaactttataaagaaaaattactaaaaaattccacagttgag
caattagaaaactgatttgtaaatgagaaaattttaagtgtaaaaaacaaaggaaaattc
attgttttttattttagtaatgacaaaattctaatttctcatttaaggttgaatgggaaa
tatttttttaataactcatctaaaaaagaaccacacaatcatttgatgattcaatttgat
gataatacttttttacattacaatgacacaaggatgtttggtacttttcatattaaaaca
acaaaagattatttaaacacaactcctttatctaatgttggaccaactccaatggaaatt
agtgaagaagaattatttaataaattacaaaaaagtaaaagatctattaaaccaacttta
ctagatcaacaaattgtttctggtttgggaaatatttatgttgatgaagttctttttgct
tgttcaattcatcccctaactaaagcgtttttgataaacaaaaatgaattaaaattaatt
aaaaaattcgccacttcaatattattaaaatcaatagaactaggtggttcgacaattaat
tcatattcctccttaaatatgcaagagggtaattttcaaaattttttacaagttcatact
aaaaaaggttttgcttgttcaagatgtaataatataatagagaaaattacagtaggagga
agaggaacatatatttgttccaattgtcaaaatgaaaaaaaacaaagtaaactataa

DBGET integrated database retrieval system