KEGG   Mycoplasma hyorhinis MCLD: SRH_03085Help
Entry
SRH_03085         CDS       T01945                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhm  Mycoplasma hyorhinis MCLD
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRH_03085
   01230 Biosynthesis of amino acids
    SRH_03085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRH_03085
   00030 Pentose phosphate pathway
    SRH_03085
   00051 Fructose and mannose metabolism
    SRH_03085
   00052 Galactose metabolism
    SRH_03085
  Energy metabolism
   00680 Methane metabolism
    SRH_03085
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SRH_03085
Enzymes [BR:mhm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SRH_03085
Protein phosphatases and associated proteins [BR:mhm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SRH_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646099..647070
Genome map
AA seq 323 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAVRAVAKKALLHNIEPLLIKEGYKGILTKQIVPAKNFDLDK
ASSEGGTIIFSSRFPEFQNNLVRQEAKAILDEFGIQALVAIGGDGTYKGAYELHKLGVKV
IGLPGTIDNDIQETDFTIGFDTALNSIVESVDRLRDTSRSHKRCFIVEVMGRDCQDLALY
GGIATGAEIIITNTHILTEEQIVNLVDQQMNQQGKTSTIVLTSKHIYKDLKAIAKFVENK
TGIATRAMSLEHTQRGGRPTAFERILATQMGHKAVELLLENKSGLAISHKNGKIEAVDIT
KVFVTKQPQDDKLVLEYNKLNQI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaataggtatcttaacatctggaggtgatgctccaggaatgaataatgct
gttagagcagttgctaaaaaagctttattacacaatatagaacctttattaattaaagaa
ggttataaaggaattttaaccaagcaaattgttccagcaaaaaattttgatttggataaa
gcttcttcagaaggaggaacaataattttttcttcaagattcccagagtttcaaaataat
ttggttagacaagaagcaaaagcaatattagatgaattcggaatccaagcactagtagca
attggtggtgatggaacatacaaaggagcctatgaacttcataaattaggagttaaagtt
attggtcttccaggaacaatcgacaatgatattcaagaaacagattttacaattggtttt
gatactgctttaaattctattgttgaatcagttgatagattaagagatacaagtagatca
cacaagagatgttttattgttgaagtaatgggaagagattgtcaagacttggcgctttat
ggtggaattgcaactggagctgaaattattattacaaatactcacattttaactgaagaa
caaatcgttaatttagttgatcaacaaatgaatcagcaaggaaaaacaagcacaattgtt
ttaacttctaaacacatttataaagacttaaaagcaattgctaagtttgttgaaaataaa
acaggtatagcaactagagcgatgtcactggaacatacacaaagaggaggaagaccaact
gcatttgaaagaattttagccactcaaatggggcacaaagcagttgaactacttttagaa
aataaatcaggcttagcaatcagccataaaaatggtaaaattgaggctgtagacattacc
aaagtgtttgttactaaacaaccccaagacgataaactagtattagaatacaacaaatta
aatcaaatttaa

DBGET integrated database retrieval system