KEGG   Mycoplasma hyorhinis MCLD: SRH_03810Help
Entry
SRH_03810         CDS       T01945                                 

Definition
Guanylate kinase Gmk
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mhm  Mycoplasma hyorhinis MCLD
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SRH_03810
Enzymes [BR:mhm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SRH_03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790477..791055
Genome map
AA seq 192 aa AA seqDB search
MAKLIVLIGPSGVGKGSIEEILFQNPNLKIKLSVSATTRDKRPNEVDGKNYYFISKEDFK
NKIKNNEFLEWNKHFNNYYGTLKSEVDNIIKEGYSPILEIETVGALNIMKMYEQANKSDQ
LVTIFIAPPTFDDLKKRIISRKTDSHEQIQLRIDKSLEELSQQHKFQYIVVNKDLKVAAK
EVEKIILKEDKN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctaatagtattaataggtccatcaggtgttggtaaaggaagcattgaagaa
attctttttcaaaatccaaatctcaaaatcaaactttcagtatcagcaacaacaagagac
aaaagacctaatgaagtagacggaaaaaattattattttatttctaaagaagattttaaa
aataaaatcaaaaataatgaatttcttgaatgaaacaaacactttaataattattacgga
acactaaaatcagaagttgataacattattaaagaaggttatagtcctattttagaaatt
gaaactgttggagcactaaacattatgaaaatgtatgagcaagcaaacaaaagtgatcaa
cttgttaccattttcatagctcctccaacatttgatgatcttaaaaaaagaataattagt
agaaaaactgattcacacgaacaaattcaattaagaattgataaatctttagaagaatta
agtcaacaacataaattccaatatattgttgttaataaagatttaaaagtagcagcaaaa
gaagttgaaaaaataattttaaaagaagataaaaactaa

DBGET integrated database retrieval system