KEGG   Mycoplasma hyopneumoniae 168: MHP168_106Help
Entry
MHP168_106        CDS       T01925                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHP168_106 (tpiA)
   01230 Biosynthesis of amino acids
    MHP168_106 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP168_106 (tpiA)
   00051 Fructose and mannose metabolism
    MHP168_106 (tpiA)
   00562 Inositol phosphate metabolism
    MHP168_106 (tpiA)
Enzymes [BR:mhn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MHP168_106 (tpiA)
Exosome [BR:mhn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MHP168_106 (tpiA)
  Exosomal proteins of bladder cancer cells
   MHP168_106 (tpiA)
  Exosomal proteins of melanoma cells
   MHP168_106 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131646..132344
Genome map
AA seq 232 aa AA seqDB search
MNKTVSETRDFIQKFDIFYQENVGKIKEDLDFAIAPSFISLSLISKSLTKKLEIAAQNLS
QFDSGAFTGEISGKMLQDLGTKYVIIGHSERREIFKEKDEELKNKILQAQKYDLIPVFCV
GESLLEFEAGLTKKVIISQINAIKSVLNFQKAIIAYEPIWAIGTGKTATAAIAEKVCGLI
KENFGKNTKVIYGGSVNSKNINELISQKSIDGALVGGASLDPEEFGKILVNS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaccgtaagtgaaacacgtgattttattcaaaaatttgacattttctatcag
gaaaatgttggcaaaatcaaagaagatttagattttgcaatagctccaagttttatatct
ttatcactaatttctaagtccttgactaaaaaattagaaattgctgctcaaaatcttagt
cagtttgattcaggagcctttactggggaaatcagtggcaaaatgctgcaggatttaggg
acaaaatatgtaattattgggcattctgaaagaagagaaatttttaaagaaaaagatgaa
gaactaaaaaataaaattttacaagcacaaaaatatgatttaattcctgttttttgtgtt
ggtgaaagtcttttagaatttgaagccggcctaactaaaaaagtgataatttcgcagata
aatgctataaaatcagtgctaaattttcaaaaggcaattattgcatatgaaccaatttgg
gccattggaactggcaaaacagcaacggctgcaatagcagaaaaagtttgtgggctgatt
aaggaaaattttgggaaaaatacaaaggtaatttatggaggttctgttaattctaagaat
attaacgagttaatatcccagaaaagcatcgatggcgcccttgtagggggcgcctctctt
gatccagaagaatttggaaaaattttagttaatagttaa

DBGET integrated database retrieval system