KEGG   Mycoplasma hyopneumoniae 168: MHP168_106Help
Entry
MHP168_106        CDS       T01925                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
mhn00010  Glycolysis / Gluconeogenesis
mhn00051  Fructose and mannose metabolism
mhn00562  Inositol phosphate metabolism
mhn01100  Metabolic pathways
mhn01110  Biosynthesis of secondary metabolites
mhn01120  Microbial metabolism in diverse environments
mhn01130  Biosynthesis of antibiotics
mhn01200  Carbon metabolism
mhn01230  Biosynthesis of amino acids
Module
mhn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mhn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP168_106 (tpiA)
   00051 Fructose and mannose metabolism
    MHP168_106 (tpiA)
   00562 Inositol phosphate metabolism
    MHP168_106 (tpiA)
Enzymes [BR:mhn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MHP168_106 (tpiA)
Exosome [BR:mhn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MHP168_106 (tpiA)
  Exosomal proteins of bladder cancer cells
   MHP168_106 (tpiA)
  Exosomal proteins of melanoma cells
   MHP168_106 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADQ90326
UniProt: E4QSA8
Position
131646..132344
Genome map
AA seq 232 aa AA seqDB search
MNKTVSETRDFIQKFDIFYQENVGKIKEDLDFAIAPSFISLSLISKSLTKKLEIAAQNLS
QFDSGAFTGEISGKMLQDLGTKYVIIGHSERREIFKEKDEELKNKILQAQKYDLIPVFCV
GESLLEFEAGLTKKVIISQINAIKSVLNFQKAIIAYEPIWAIGTGKTATAAIAEKVCGLI
KENFGKNTKVIYGGSVNSKNINELISQKSIDGALVGGASLDPEEFGKILVNS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaccgtaagtgaaacacgtgattttattcaaaaatttgacattttctatcag
gaaaatgttggcaaaatcaaagaagatttagattttgcaatagctccaagttttatatct
ttatcactaatttctaagtccttgactaaaaaattagaaattgctgctcaaaatcttagt
cagtttgattcaggagcctttactggggaaatcagtggcaaaatgctgcaggatttaggg
acaaaatatgtaattattgggcattctgaaagaagagaaatttttaaagaaaaagatgaa
gaactaaaaaataaaattttacaagcacaaaaatatgatttaattcctgttttttgtgtt
ggtgaaagtcttttagaatttgaagccggcctaactaaaaaagtgataatttcgcagata
aatgctataaaatcagtgctaaattttcaaaaggcaattattgcatatgaaccaatttgg
gccattggaactggcaaaacagcaacggctgcaatagcagaaaaagtttgtgggctgatt
aaggaaaattttgggaaaaatacaaaggtaatttatggaggttctgttaattctaagaat
attaacgagttaatatcccagaaaagcatcgatggcgcccttgtagggggcgcctctctt
gatccagaagaatttggaaaaattttagttaatagttaa

DBGET integrated database retrieval system