KEGG   Mycoplasma hyopneumoniae 168: MHP168_150Help
Entry
MHP168_150        CDS       T01925                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MHP168_150 (gmk)
Enzymes [BR:mhn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MHP168_150 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169874..170467
Genome map
AA seq 197 aa AA seqDB search
MKVKMSKLIILSGPSGVGKGTIESLLLKNKNLLIKLAISATTREKRRDEINGVNYFFLTV
QEFKEKIENDEFIEWSCHFNNYYGTLKSQIKFIQSQNFIPLLEIDTTGAKNIIENYKNKG
ELSQLLTIFILPPSIESLKNRIQKRLTETNIQINQRLEKAKAEIKIKNLFKFQVVNDNLE
ECVAQIEKIISKEIQKT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaaatgagtaaattaataattttgtctggaccttcaggggttggcaagggc
acaattgaatcacttttattaaaaaataaaaatttattaataaagttagcaatttctgca
acaactcgagaaaaaaggagagacgaaattaacggagttaattattttttcctaacagtt
caagagtttaaagaaaaaattgaaaatgatgaatttattgaatgaagttgtcattttaat
aattattatgggacgctaaaatcgcagattaagtttattcagtctcaaaattttatccca
ttattggaaattgatacaacaggtgctaaaaatattattgaaaattacaaaaataaaggt
gaattatcccaacttttaactatttttatcctccctccttccattgaatctcttaaaaac
cggattcaaaaacgtctaacagaaacaaatattcaaataaatcaacgactagaaaaagcc
aaagctgagattaaaattaaaaatttgttcaaatttcaagtggttaatgacaatttagaa
gaatgtgttgcccaaatagaaaaaattataagtaaagagatccaaaaaacttag

DBGET integrated database retrieval system