KEGG   Mycoplasma hyopneumoniae 168: MHP168_191Help
Entry
MHP168_191        CDS       T01925                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mhn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mhn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mhn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mhn00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mhn00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mhn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208999..209967
Genome map
AA seq 322 aa AA seqDB search
MSKKIGILTSGGDAPGMNSAISFLAKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNG
ISSFGGTAIGSSRFPEFKKEEIQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKV
IALPGTIDNDIQFTDYTIGFDTALNTIVETIDKLRDTANSHRRCFVVEVMGRHCQDLALY
SAMATGSEILITNTNILTLEEVSQKVLEQFAKGKPSVIVTITENILPNLKEFAAKIEELT
KISTRSLEVGHTQRGGRPSAFDRILAAKMAMKAMELINQDKSGLAISYLDGKIQTFDIAK
VVSNPVRKTNDLVLEINKINQN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaatcggtatattaacttcaggcggcgatgcgcctgggatgaattctgca
ataagttttttggcaaaatcagcacttagtttaggttttgagccatatttaatttttgat
ggctattctggaataatcgcaagaaaaatattgccagcaaaaaattttccttataatgga
atttctagttttggcggaactgccataggatcaagtcgctttcctgaatttaaaaaagag
gaaattcaaaataaagccgttgaaattttaagtgagattgggattagttcgctggtggta
gttggtggcgatggaacctataatggcggttataaattacatttaaaaggaataaaagta
atcgctttaccaggaaccattgataatgatatccagtttactgattatacaattggattt
gatactgctttgaatacgatagttgaaactattgataaattaagggatacggcgaattct
catcgtcgttgttttgtagttgaagttatgggcagacattgtcaagatttagctttatat
tcggcaatggcaactggaagcgaaattttaattactaatacaaatattttaacccttgaa
gaggtaagtcaaaaagttttagaacagtttgcaaaaggcaaaccaagcgtgatagtaaca
attacagagaatattttaccaaacctaaaagagtttgcggctaaaattgaggagttaaca
aaaatttccactcgttctttagaagttggtcatacccagcgcggcggtagaccttccgct
tttgaccgaattttagcagccaagatggcaatgaaagctatggaattaattaatcaagat
aaatcaggtcttgcaattagttatttagatggtaaaattcaaacttttgatattgcgaaa
gtagtatcaaatcctgttagaaaaacaaacgacttagtgcttgaaattaataaaatcaat
caaaattaa

DBGET integrated database retrieval system