KEGG   Mycoplasma hyopneumoniae 168: MHP168_191Help
Entry
MHP168_191        CDS       T01925                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHP168_191 (pfkA)
   01230 Biosynthesis of amino acids
    MHP168_191 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP168_191 (pfkA)
   00030 Pentose phosphate pathway
    MHP168_191 (pfkA)
   00051 Fructose and mannose metabolism
    MHP168_191 (pfkA)
   00052 Galactose metabolism
    MHP168_191 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MHP168_191 (pfkA)
Enzymes [BR:mhn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHP168_191 (pfkA)
Protein phosphatases and associated proteins [BR:mhn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHP168_191 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208999..209967
Genome map
AA seq 322 aa AA seqDB search
MSKKIGILTSGGDAPGMNSAISFLAKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNG
ISSFGGTAIGSSRFPEFKKEEIQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKV
IALPGTIDNDIQFTDYTIGFDTALNTIVETIDKLRDTANSHRRCFVVEVMGRHCQDLALY
SAMATGSEILITNTNILTLEEVSQKVLEQFAKGKPSVIVTITENILPNLKEFAAKIEELT
KISTRSLEVGHTQRGGRPSAFDRILAAKMAMKAMELINQDKSGLAISYLDGKIQTFDIAK
VVSNPVRKTNDLVLEINKINQN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaatcggtatattaacttcaggcggcgatgcgcctgggatgaattctgca
ataagttttttggcaaaatcagcacttagtttaggttttgagccatatttaatttttgat
ggctattctggaataatcgcaagaaaaatattgccagcaaaaaattttccttataatgga
atttctagttttggcggaactgccataggatcaagtcgctttcctgaatttaaaaaagag
gaaattcaaaataaagccgttgaaattttaagtgagattgggattagttcgctggtggta
gttggtggcgatggaacctataatggcggttataaattacatttaaaaggaataaaagta
atcgctttaccaggaaccattgataatgatatccagtttactgattatacaattggattt
gatactgctttgaatacgatagttgaaactattgataaattaagggatacggcgaattct
catcgtcgttgttttgtagttgaagttatgggcagacattgtcaagatttagctttatat
tcggcaatggcaactggaagcgaaattttaattactaatacaaatattttaacccttgaa
gaggtaagtcaaaaagttttagaacagtttgcaaaaggcaaaccaagcgtgatagtaaca
attacagagaatattttaccaaacctaaaagagtttgcggctaaaattgaggagttaaca
aaaatttccactcgttctttagaagttggtcatacccagcgcggcggtagaccttccgct
tttgaccgaattttagcagccaagatggcaatgaaagctatggaattaattaatcaagat
aaatcaggtcttgcaattagttatttagatggtaaaattcaaacttttgatattgcgaaa
gtagtatcaaatcctgttagaaaaacaaacgacttagtgcttgaaattaataaaatcaat
caaaattaa

DBGET integrated database retrieval system