KEGG   Mycoplasma hyopneumoniae 168: MHP168_279Help
Entry
MHP168_279        CDS       T01925                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHP168_279 (recR)
DNA repair and recombination proteins [BR:mhn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MHP168_279 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327629..328213
Genome map
AA seq 194 aa AA seqDB search
MIKETFKNLAEDLRKIPGISKKQAMRILSFLVDVPIEKIENFVRAICDLKKNTQYCEKCG
YLNTNPVCEICLDFQRSFKILVVENTEMIAKFEEYGKYDGQYFVFGKYDIKNLENHNAQI
KKLADLAANKSEIILGLSSTMEGLIFANYLAKHEFLSGLKITRLATGIPFGAIIDYIDNI
TLDQALKNRQEMEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagaaacatttaaaaatcttgctgaggatttaagaaaaatcccgggaatttcc
aaaaaacaagcaatgcgaattttgtcttttttggttgatgttccaattgaaaaaattgaa
aattttgttagagcaatttgtgatttgaaaaaaaacacacaatattgtgaaaaatgtggg
tatttaaatactaatccagtttgtgaaatatgccttgatttccaacggtcttttaaaatt
ttagtagttgaaaataccgaaatgattgctaaatttgaagaatatggaaaatatgatggt
caatattttgtctttggtaaatatgatattaaaaatttagaaaatcataatgcccaaatt
aaaaaattagctgatttagccgctaataaaagtgagataattcttggtttatcttcgaca
atggagggactgatttttgcaaattatctcgcaaaacacgagtttttatccggccttaaa
attactcggcttgcaactggaattccatttggagcaataattgattatatcgataatatc
accttagatcaagcgcttaaaaatcgacaagaaatggaaaaataa

DBGET integrated database retrieval system