KEGG   Mycoplasma hyopneumoniae 168: MHP168_430Help
Entry
MHP168_430        CDS       T01925                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHP168_430 (ruvA)
Enzymes [BR:mhn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MHP168_430 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529822..530487
Genome map
AA seq 221 aa AA seqDB search
MQIYQFGKIVSKNKNYLILENHGSGYLIYVPRIDRFNRDENRKIYIYEHENDYTKITYGF
ASFRERILFEDLISIQGVGPKTAISALNSGMQNLINLIAANDWKTLAKIPYLSEKNAKQI
VFEFQKKYERFNENHKNQAEETNQDTQEKELEKKDDLADITIQKSNLEDRTAANLEDTLK
MLGFKPRQIDYALTKVEPNENFENLIENAIKIISNAREFRN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctatcaattcggaaaaattgtctcaaaaaacaaaaactatttaattcttgaa
aaccacggcagcggctatcttatttatgtacctcgaatcgatcgctttaaccgcgacgaa
aatcgcaaaatttatatttatgaacatgaaaatgactatacaaaaataacttacggtttt
gcgagcttccgtgagcggattttgtttgaagatctaatttcaattcaaggggttggacct
aaaaccgcaatttctgcacttaattcgggaatgcagaatttaattaatttaattgccgca
aacgactgaaaaacgctggcaaaaattccttatctttctgagaaaaatgcaaaacaaata
gtctttgaatttcaaaaaaaatacgaaagatttaacgaaaaccataaaaaccaagcagag
gaaacaaatcaagacactcaagaaaaagaactagaaaaaaaggatgatttagctgatatt
accatccaaaaatcaaatcttgaagacagaacggccgcaaatcttgaggatactttgaaa
atgcttggtttcaaaccacggcaaattgattatgcgcttacaaaagttgaacctaatgaa
aattttgaaaatttaattgaaaacgcaattaaaattatatcaaatgccagagaatttaga
aattag

DBGET integrated database retrieval system