KEGG   Mycoplasma hyopneumoniae 168: MHP168_513Help
Entry
MHP168_513        CDS       T01925                                 

Gene name
pdhC
Definition
Dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mhn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mhn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mhn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mhn00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
666464..667384
Genome map
AA seq 306 aa AA seqDB search
MSKILATPKARAMAKHANIDLADLKIQHRKIEASDVENYIKSLKSAQTSAEKVEVSSSQQ
AEKTSIPASIPPKLEGKREKIAPIRKAIARAMTNSWNSVAYVNLVNQIDVSDLWKLRKSV
LDPVLKTSGVKLTFLAFIAKAILIALSEFPVMAAKYDEATSEIVYPDTLNLGLAVDTDAG
LMVPVIKDAQKLSIVEIAKEIVRLAKAARERKIKPSEMQGGSFTITNYGSVGSLYGVPVI
NYPELAIAGVGAIIDSAEVKDGQIVASKIMHLTVAADHRWIDGATIGRFAARVKELLEKP
EILGIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattttagcaaccccaaaagcaagagcgatggcaaaacatgctaatattgat
cttgctgatcttaaaattcaacatcggaaaattgaagcttccgatgttgaaaattacata
aaatccttaaaatcagcacaaactagtgctgaaaaagtagaagtttcatcgtctcagcag
gctgaaaaaacttctattcccgcgtcaattccgcctaaattagaaggaaaacgcgagaaa
atcgctccaattcgaaaagcaattgcaagagcgatgactaattcttgaaattcagttgcc
tatgtcaacctcgttaatcaaattgacgttagcgatctttgaaaacttagaaaatcagtt
ttagaccctgtcctaaaaacatcaggtgtgaaactaacatttcttgcttttattgccaaa
gccattttgattgctcttagtgaatttcctgttatggcagcaaaatatgatgaagcaaca
agtgaaattgtctatcctgatactttaaatttaggtcttgctgtcgatactgacgccggg
cttatggttccagtaattaaggatgctcaaaagctttcaattgtagaaattgcaaaagaa
attgttcgtcttgccaaagctgcccgtgaacgtaaaattaaaccaagcgaaatgcaaggt
ggatcatttacaatcacaaattatggatcggttggttcactttatggtgttccagtaata
aattatcctgaactggcaattgctggagtaggagctattattgattcagccgaggtcaag
gatggtcaaattgttgcttcaaaaattatgcatttaacagttgctgcagatcatcgttga
attgatggtgcaacaattggtcgttttgctgcaagagttaaagaattattagaaaaacca
gaaattttaggaatcttataa

DBGET integrated database retrieval system