KEGG   Mycoplasma hyopneumoniae 168: MHP168_513Help
Entry
MHP168_513        CDS       T01925                                 

Gene name
pdhC
Definition
Dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHP168_513 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP168_513 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MHP168_513 (pdhC)
   00620 Pyruvate metabolism
    MHP168_513 (pdhC)
Enzymes [BR:mhn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MHP168_513 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
666464..667384
Genome map
AA seq 306 aa AA seqDB search
MSKILATPKARAMAKHANIDLADLKIQHRKIEASDVENYIKSLKSAQTSAEKVEVSSSQQ
AEKTSIPASIPPKLEGKREKIAPIRKAIARAMTNSWNSVAYVNLVNQIDVSDLWKLRKSV
LDPVLKTSGVKLTFLAFIAKAILIALSEFPVMAAKYDEATSEIVYPDTLNLGLAVDTDAG
LMVPVIKDAQKLSIVEIAKEIVRLAKAARERKIKPSEMQGGSFTITNYGSVGSLYGVPVI
NYPELAIAGVGAIIDSAEVKDGQIVASKIMHLTVAADHRWIDGATIGRFAARVKELLEKP
EILGIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattttagcaaccccaaaagcaagagcgatggcaaaacatgctaatattgat
cttgctgatcttaaaattcaacatcggaaaattgaagcttccgatgttgaaaattacata
aaatccttaaaatcagcacaaactagtgctgaaaaagtagaagtttcatcgtctcagcag
gctgaaaaaacttctattcccgcgtcaattccgcctaaattagaaggaaaacgcgagaaa
atcgctccaattcgaaaagcaattgcaagagcgatgactaattcttgaaattcagttgcc
tatgtcaacctcgttaatcaaattgacgttagcgatctttgaaaacttagaaaatcagtt
ttagaccctgtcctaaaaacatcaggtgtgaaactaacatttcttgcttttattgccaaa
gccattttgattgctcttagtgaatttcctgttatggcagcaaaatatgatgaagcaaca
agtgaaattgtctatcctgatactttaaatttaggtcttgctgtcgatactgacgccggg
cttatggttccagtaattaaggatgctcaaaagctttcaattgtagaaattgcaaaagaa
attgttcgtcttgccaaagctgcccgtgaacgtaaaattaaaccaagcgaaatgcaaggt
ggatcatttacaatcacaaattatggatcggttggttcactttatggtgttccagtaata
aattatcctgaactggcaattgctggagtaggagctattattgattcagccgaggtcaag
gatggtcaaattgttgcttcaaaaattatgcatttaacagttgctgcagatcatcgttga
attgatggtgcaacaattggtcgttttgctgcaagagttaaagaattattagaaaaacca
gaaattttaggaatcttataa

DBGET integrated database retrieval system