KEGG   Mycoplasma hyopneumoniae 168: MHP168_526Help
Entry
MHP168_526        CDS       T01925                                 

Gene name
glcK
Definition
Glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHP168_526 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP168_526 (glcK)
   00052 Galactose metabolism
    MHP168_526 (glcK)
   00500 Starch and sucrose metabolism
    MHP168_526 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MHP168_526 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MHP168_526 (glcK)
   00524 Butirosin and neomycin biosynthesis
    MHP168_526 (glcK)
Enzymes [BR:mhn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MHP168_526 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679983..680876
Genome map
AA seq 297 aa AA seqDB search
MIKYNFATIDIGGTNTRFAIFSDNKITKKIKFATDVIDYKKILDKILDLVSKYKINAIAL
CIPGPANYQKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNT
KKGVTQFYTISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFIS
GTGMSLRAKDKNLEQTEPKNIIALSQEDKGYRQIVGDCIDTLARTISITIGILNPNLMVF
GGSIAEYNFWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatataattttgccactatcgacatcggcggaacaaatactcgttttgcaatt
tttagtgataataaaatcacaaaaaaaattaaatttgccactgatgttatagattataaa
aaaattcttgataaaattcttgatctagttagcaaatacaagattaacgcaatcgccttg
tgcatccctggtccggctaattatcaaaaagggattattctctcttcgcctaatttaata
ggctgaaatggaataaatattaaggaatatctcctaaataattctaaattagaatatgct
atctttgaaaatgatgcaaatgcaatggcatttgccaatcatattttttataaaaatacc
aaaaaaggcgtaactcagttttatacaatctcaactggttttggtgctggactcgtaatt
aataataaaatttttcatggtgctaatggttttggacaggaaattgcacatattccaacc
tcaaaaatatttaataaaaagcatcatctaaataattatgcagctgaattatttatctcg
ggaacaggaatgtctttaagagctaaagataaaaacttagaacaaaccgaaccaaaaaat
attatcgcactatctcaagaagataaaggctacagacaaattgttggcgactgtattgat
accttggcgcgaacaatttcgataacaattggaattttaaatcctaatttgatggttttt
ggcggttctatagctgagtataatttttgaataattcaaaaagcgatcaaaaaagcgaaa
cagtgaacaaataaagaccaatgagaagctataaagtttgaaaaagatccttttggtgat
gattcggctttatttgggctttactacctaatattagaaaaaacaaagaaataa

DBGET integrated database retrieval system