KEGG   Mycoplasma hyopneumoniae 168: MHP168_526Help
Entry
MHP168_526        CDS       T01925                                 

Gene name
glcK
Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mhn  Mycoplasma hyopneumoniae 168
Pathway
mhn00010  Glycolysis / Gluconeogenesis
mhn00052  Galactose metabolism
mhn00500  Starch and sucrose metabolism
mhn00520  Amino sugar and nucleotide sugar metabolism
mhn00521  Streptomycin biosynthesis
mhn01100  Metabolic pathways
mhn01110  Biosynthesis of secondary metabolites
mhn01120  Microbial metabolism in diverse environments
mhn01130  Biosynthesis of antibiotics
mhn01200  Carbon metabolism
Module
mhn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP168_526 (glcK)
   00052 Galactose metabolism
    MHP168_526 (glcK)
   00500 Starch and sucrose metabolism
    MHP168_526 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MHP168_526 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MHP168_526 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MHP168_526 (glcK)
Enzymes [BR:mhn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MHP168_526 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N FtsA
Motif
Other DBs
NCBI-ProteinID: ADQ90722
UniProt: E4QTH5
Position
679983..680876
Genome map
AA seq 297 aa AA seqDB search
MIKYNFATIDIGGTNTRFAIFSDNKITKKIKFATDVIDYKKILDKILDLVSKYKINAIAL
CIPGPANYQKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNT
KKGVTQFYTISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFIS
GTGMSLRAKDKNLEQTEPKNIIALSQEDKGYRQIVGDCIDTLARTISITIGILNPNLMVF
GGSIAEYNFWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatataattttgccactatcgacatcggcggaacaaatactcgttttgcaatt
tttagtgataataaaatcacaaaaaaaattaaatttgccactgatgttatagattataaa
aaaattcttgataaaattcttgatctagttagcaaatacaagattaacgcaatcgccttg
tgcatccctggtccggctaattatcaaaaagggattattctctcttcgcctaatttaata
ggctgaaatggaataaatattaaggaatatctcctaaataattctaaattagaatatgct
atctttgaaaatgatgcaaatgcaatggcatttgccaatcatattttttataaaaatacc
aaaaaaggcgtaactcagttttatacaatctcaactggttttggtgctggactcgtaatt
aataataaaatttttcatggtgctaatggttttggacaggaaattgcacatattccaacc
tcaaaaatatttaataaaaagcatcatctaaataattatgcagctgaattatttatctcg
ggaacaggaatgtctttaagagctaaagataaaaacttagaacaaaccgaaccaaaaaat
attatcgcactatctcaagaagataaaggctacagacaaattgttggcgactgtattgat
accttggcgcgaacaatttcgataacaattggaattttaaatcctaatttgatggttttt
ggcggttctatagctgagtataatttttgaataattcaaaaagcgatcaaaaaagcgaaa
cagtgaacaaataaagaccaatgagaagctataaagtttgaaaaagatccttttggtgat
gattcggctttatttgggctttactacctaatattagaaaaaacaaagaaataa

DBGET integrated database retrieval system