KEGG   Mycoplasma hominis: MHO_0970Help
Entry
MHO_0970          CDS       T01122                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mho  Mycoplasma hominis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mho03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124954..125544
Genome map
AA seq 196 aa AA seqDB search
MNNIEIQKLEELLKTVFDFTKKQSQKFIFNIFKSSSEDIDQICNQIKALRNSIKKCNICN
RYNENTICNICLDTNRTKQLMLVGNSLDIDKFENIGLYKGKYFVFDQNISLKNEDFIVSS
LLEKLIDILKDKNELILSLSPTIEGQFNMHYIKKFLKNKINFTNVFQLSTGIPLGSSVEY
IDQDTLKESLLNKIKM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaataatattgagatacaaaaactagaagaacttttaaaaacagtttttgattttact
aaaaaacaatctcaaaaatttatattcaacatttttaaatcatcaagtgaagatatagat
caaatttgcaatcaaataaaagcattgagaaattcaataaagaagtgtaatatttgcaat
agatataacgaaaatacaatttgcaatatttgcttggacactaatcgaacaaaacaactt
atgttagttggcaattcgttagatattgataaatttgaaaatattggtttgtataaagga
aaatattttgtatttgatcaaaatataagcttaaagaatgaagattttatagtttcaagt
ttattagaaaaattaatagatatattaaaagataagaatgaactaattctttcactttcc
ccaactattgagggtcaatttaatatgcattatattaaaaaattcttgaaaaacaaaata
aattttacaaatgtttttcaattgtcaactggtattcctttgggctcatcagttgaatat
attgatcaagatacattaaaagaatcattattgaataaaatcaaaatgtag

DBGET integrated database retrieval system