KEGG   Mycoplasma hominis ATCC 23114: MHO_1840Help
Entry
MHO_1840          CDS       T01122                                 

Gene name
ruvA
Definition
holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mho  Mycoplasma hominis ATCC 23114
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mho00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHO_1840 (ruvA)
Enzymes [BR:mho01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MHO_1840 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220287..220907
Genome map
AA seq 206 aa AA seqDB search
MKIYLYGKIMHVNTNYLILDHNGEGELIYVADIKRFNKDDLRKIFIYDVVNEYKKTTYGF
ENFKELIIFEDLISLQGLGPKTAISLLNLGWENLIQLIANEDKDKLCEASYVSLRIANNI
IFAYKQKYAKFLSKLSDEDLLKIKSKNTSDSLREKFEYTMRMLGFKKQQISYALEKMSIT
ENIEESVENAIKIIGMKQNESRVLDQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatatttatatggaaaaataatgcacgtaaacactaactatttaattttagat
cataatggtgagggtgaattgatatacgtggcagatataaaaagatttaataaggatgat
ctgagaaaaatatttatttacgatgtggtaaatgaatataaaaaaactacttatggattt
gaaaattttaaagaattaataatttttgaagatttaatttcattacaaggtttaggacct
aagacagcaatttctcttctaaatttaggatgagaaaatttaattcaactaattgcaaac
gaagataaagataaattatgcgaagcgtcttatgtaagtttgaggattgcaaacaatata
atttttgcctataaacaaaaatatgcaaaatttttatcaaaattaagcgatgaagattta
cttaaaatcaagagcaaaaacacaagcgactctttaagagaaaaatttgaatatacaatg
agaatgctcggttttaaaaaacaacaaatttcatacgcattagaaaaaatgagtataacc
gaaaatattgaagaatcagttgaaaatgcaataaaaataattggaatgaagcaaaatgag
tcaagagttctcgatcaatag

DBGET integrated database retrieval system