KEGG   Mycoplasma hominis ATCC 23114: MHO_2400Help
Entry
MHO_2400          CDS       T01122                                 

Gene name
tpiA
Definition
(RefSeq) Triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mho  Mycoplasma hominis ATCC 23114
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHO_2400 (tpiA)
   01230 Biosynthesis of amino acids
    MHO_2400 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHO_2400 (tpiA)
   00051 Fructose and mannose metabolism
    MHO_2400 (tpiA)
   00562 Inositol phosphate metabolism
    MHO_2400 (tpiA)
Enzymes [BR:mho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MHO_2400 (tpiA)
Exosome [BR:mho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MHO_2400 (tpiA)
  Exosomal proteins of bladder cancer cells
   MHO_2400 (tpiA)
  Exosomal proteins of melanoma cells
   MHO_2400 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(295450..296181)
Genome map
AA seq 243 aa AA seqDB search
MKYLIGNLKMNLSYLESQNYLNELQSLNKIKNFKNVIIGAALSFDAMSLSLQYNKRNFLF
GVQNIFYKEKGAYTGEVSFRSAVELNIDFVLIGHSERRKLFNETDQLINLKIKQIEKTSI
IPILCIGEDQENCSDKVFEDIIKNQILKALEDVDVYNRLIISYEPTYCIGNGKIPQNYHI
EKAISVIKKITNNQVPVLYGGSVSQKNIEKLLEIKDLDGFLVGGAALDAQGFLEMGSIIE
KNN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttaattggtaatttaaaaatgaatctatcttatttagaaagtcagaattat
ttaaatgaactacaatcattaaataaaattaaaaattttaaaaatgtaataattggagcg
gctttgtcattcgatgcaatgtctctgtctttacaatataataaaagaaattttttgttt
ggagttcaaaatattttttataaagaaaaaggtgcatacactggggaagtttcatttaga
tcagcagttgaattgaacattgactttgttttaataggacatagtgaacgtagaaaatta
tttaatgaaactgatcaattgattaatttaaaaattaaacaaattgaaaaaactagcatt
attcctattttgtgtataggggaagatcaagaaaattgtagcgataaagtctttgaagat
attataaaaaaccaaatattaaaagctttagaagatgttgatgtttataatcgtttaatt
atttcatacgaacctacttattgcattggaaatggaaaaattcctcaaaattaccatatt
gaaaaagcaatatctgtaattaaaaaaattactaataatcaagttccggtgttgtatggc
ggttcagtttcacaaaaaaatattgaaaaattgcttgaaattaaggatttggatggtttt
ttagttggcggagcagcattagatgctcaaggttttttagaaatgggttcaataatagaa
aaaaacaactag

DBGET integrated database retrieval system