KEGG   Mycoplasma hominis: MHO_3010Help
Entry
MHO_3010          CDS       T01122                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mho  Mycoplasma hominis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mho00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MHO_3010
Enzymes [BR:mho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MHO_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349027..351417
Genome map
AA seq 796 aa AA seqDB search
MISKIYDDKKYLEKMDKWFRAANYLGVCQMYLRDNPLLKKPLTSNDIKLYPIGHWGTVPG
QNFIYTHLNRVIKKYDLNMFYIEGPGHGGQVMISNSYLDGSYSEIYPEISQDEAGLAKMF
KRFSFPGGTASHAAPETPGSIHEGGELGYSISHGTGAILDNPDVICAAVVGDGEAETGPL
ATSWFSNAFINPVNDGAILPILHLNGGKISNPTLLSRKPKEEIKKYFEGLGWNPIFVEWS
EDKSNLDMHELMAKSLDKAIESIKEIQAEARKKPAEEATRPTWPMIVLRTPKGWTGPKQW
NNEAIEGSFRAHQVPIPVSAFKMEKIADLEKWLKSYKPEELFDENGTIIKEIRDLAPEGL
KRMAVNPITNGGIDSKPLKLQDWKKYALKIDYPGEIKAQDMAEMAKFAADIMKDNPSSFR
VFGPDETKSNRMFALFNVTNRQWLEPVSKKYDEWISPAGRIIDSQLSEHQCEGFLEGYVL
TGRHGFFASYEAFLRVVDSMLTQHMKWIKKASELSWRKTYPSLNIIATSNAFQQDHNGYT
HQDPGLLGHLADKRPEIIREYLPADTNSLLAVMNKALTERNVINLIVASKQPREQFFTVE
DAEELLEKGYKVVPWASNISENEEPDIVFASSGVEPNIESLAAISLINQEYPHLKIRYVY
VLDLLKLRSRKIDPRGISDEEFDKVFTKNKPIIFAFHGFEGLLRDIFFTRSNHNLIAHGY
RENGDITTSFDIRQLSEMDRYHIAKDAAEAVYGKDAKAFMNKLDQKLEYHRNYIDEYGYD
MPEVVEWKWKNINKEN
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaaaatttatgatgataaaaaatatcttgaaaaaatggataaatgatttaga
gctgctaattatttaggcgtatgtcaaatgtatttaagagacaatcctttgctaaaaaag
cctttaacatcaaatgatattaaactatatcctattggacactgaggaacagttcctgga
caaaactttatttatacacatttaaatagagtaattaagaaatatgacttaaatatgttt
tatattgaaggcccaggacatggtggacaagttatgatttcaaactcttatcttgatgga
tcttattcagaaatatatcctgaaatatctcaagatgaagctggacttgcaaaaatgttc
aaaagattctcattccctggtggaactgcaagccatgcagcacctgaaacacctggatca
attcatgaaggtggtgaattaggatattctataagccatggaacaggagcaatattagat
aaccctgatgttatttgcgcagctgttgttggcgatggtgaagcagaaacaggcccacta
gcaactagctgattctcaaatgcttttattaaccctgtaaatgatggagcaatacttcct
atattacatttgaatggtggaaaaatttcaaaccctacacttctttcaagaaaaccaaaa
gaagaaattaaaaaatacttcgaaggtttaggctgaaatccaattttcgttgaatgaagc
gaagataaaagcaatcttgacatgcatgaattaatggcaaaatcattagataaagctatt
gaatcaattaaagaaattcaagcagaagcaagaaaaaaaccagccgaagaagcaacaaga
ccaacttgacctatgattgttttaagaacccctaagggatgaactggaccaaagcaatga
aacaatgaagctattgaaggaagctttagagctcaccaagttcctattcctgtttcagca
ttcaagatggaaaaaattgctgacttagaaaaatgattaaaatcatataaaccagaagaa
ttatttgatgaaaatggaactataataaaagaaattagagatcttgcaccagaaggtcta
aagagaatggctgttaatccaattacaaatggcggaatcgatagcaaacctttaaaatta
caagattgaaaaaaatatgctttaaaaattgactatcctggagaaataaaagcccaagat
atggcagaaatggcaaaatttgccgctgatataatgaaagataacccttcatcatttaga
gtatttggacccgatgaaactaaatcaaatcgtatgtttgcattattcaatgtaacaaat
agacaatgactagaaccagtttctaagaaatacgatgaatgaatttcacctgcaggtaga
attattgactcgcaattaagtgaacaccaatgtgaaggtttcctagaaggttacgtatta
accggaagacatggtttctttgcatcatatgaagcatttttaagagttgttgattcaatg
cttactcaacatatgaaatgaattaagaaagcttcagaattatcatgaagaaaaacctac
ccttcattaaatattattgcaacttcaaacgctttccaacaagaccacaatggttacact
caccaagacccaggacttttaggacacttagctgataaaagaccagaaattattagagaa
tacttaccagctgatacaaacagtttactagcagtaatgaataaagccttaactgaaaga
aatgtaattaacttaattgttgcttcaaaacaaccaagagaacaattctttacagttgaa
gatgctgaagaattactagaaaaaggttataaagttgttccttgagcttcaaatatttca
gaaaatgaagaaccagatatcgtatttgcttcaagtggtgttgaaccaaacattgaatca
ttggctgctatttcactaattaaccaagaatatccacatctaaaaataagatatgtttat
gttcttgacttattaaaattgagatctagaaaaatagatccaagaggaattagcgatgaa
gaatttgataaggtatttactaaaaataaacctatcatatttgctttccatggatttgaa
ggattattaagagacatcttctttacaagatctaaccacaatttaattgcacacggatat
cgtgaaaacggtgatattacaacatcattcgatattagacaattaagtgaaatggataga
tatcatattgctaaagatgcagcagaagcagtatatggaaaagatgcaaaagcatttatg
aataaattagaccaaaaactagaatatcatagaaactacattgatgaatatggatatgat
atgccagaagttgttgaatgaaaatgaaagaacataaacaaagaaaattaa

DBGET integrated database retrieval system