KEGG   Mycoplasma hominis ATCC 23114: MHO_3980Help
Entry
MHO_3980          CDS       T01122                                 

Definition
(GenBank) Endo-1,4-beta-glucanase
Organism
mho  Mycoplasma hominis ATCC 23114
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(488001..489086)
Genome map
AA seq 361 aa AA seqDB search
MTRENQFKERLIKYMEIEAMSRYEEPVVNELKKELANEGFEFSRDNFGCLIMHKPSKNPN
APKVLLAAHMDEVGYVVRNFDKKGQLYLSTVGGVWPCAVIGTKAKLITSNNETFIGLFGH
TSIHIMQEEERKKAITENELFADFGFKSDEDAIAHGVNVGDRVYMSGETILFNDQNLIGG
KAMDNRAGVTVLEFVAKAVAKLDLDIDLYLVGTVQEEVGTRGAKTVASMIDPDISIAVDT
SASHDTPNTIPGNVSLYKGAALRLKDRGTMMDPKLVQFFVDLSKKYNIPTFKYVAMGGGT
DAFELQFSKGGAATLTISLPQRYLHSPIGVCCISDLLAAVDLLTKFLTDFKQSDWENIQY
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagaaaatcaattcaaagaaagattaataaaatatatggaaattgaagcaatg
tctcgttatgaagaaccagttgttaatgaattaaaaaaagaattagctaatgaaggattt
gaatttagcagagataattttggctgtttaattatgcacaagccatctaaaaatccaaat
gctcctaaagttttattagcagcacacatggatgaagttggatatgtagtaagaaatttt
gataaaaaaggacaattatatttatcaacagttggtggcgtatgaccatgtgcagttatt
ggaaccaaagcaaaattaattacttcaaataacgaaacatttattggattatttggacat
acaagtattcatataatgcaagaagaagaaagaaagaaagcaattacagaaaatgaatta
tttgctgattttggtttcaaaagcgatgaagatgctattgctcatggtgttaatgttggt
gatagagtttacatgagcggagaaacaatactatttaatgatcaaaatttaattggtgga
aaagcaatggacaaccgtgctggtgtaaccgtgttagaatttgttgctaaagctgttgca
aaattagatcttgacattgatctatatttagtaggtacggttcaagaagaagttggaaca
agaggagctaaaacagttgcgtctatgattgatccagacatttcaatagcagttgatact
tctgcatctcacgatacacctaatacaattcctggaaatgtttctttatataagggagct
gctttaagattaaaagatagaggaacaatgatggatccaaaattggtacaattttttgtt
gatttatctaagaaatataatattccaacatttaaatatgtagccatgggtggtggtact
gatgcctttgaattacaattttcaaaaggtggggcagccacattaacaatttcattacct
caaagatatttgcattcaccaattggagtatgttgcataagtgatttattggcagccgtt
gatttgttaacaaaatttttaactgattttaaacaatctgattgagaaaatattcaatat
aaataa

DBGET integrated database retrieval system