KEGG   Mycoplasma hominis ATCC 23114: MHO_3980Help
Entry
MHO_3980          CDS       T01122                                 

Definition
Endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mho  Mycoplasma hominis ATCC 23114
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MHO_3980
Enzymes [BR:mho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MHO_3980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(488001..489086)
Genome map
AA seq 361 aa AA seqDB search
MTRENQFKERLIKYMEIEAMSRYEEPVVNELKKELANEGFEFSRDNFGCLIMHKPSKNPN
APKVLLAAHMDEVGYVVRNFDKKGQLYLSTVGGVWPCAVIGTKAKLITSNNETFIGLFGH
TSIHIMQEEERKKAITENELFADFGFKSDEDAIAHGVNVGDRVYMSGETILFNDQNLIGG
KAMDNRAGVTVLEFVAKAVAKLDLDIDLYLVGTVQEEVGTRGAKTVASMIDPDISIAVDT
SASHDTPNTIPGNVSLYKGAALRLKDRGTMMDPKLVQFFVDLSKKYNIPTFKYVAMGGGT
DAFELQFSKGGAATLTISLPQRYLHSPIGVCCISDLLAAVDLLTKFLTDFKQSDWENIQY
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagaaaatcaattcaaagaaagattaataaaatatatggaaattgaagcaatg
tctcgttatgaagaaccagttgttaatgaattaaaaaaagaattagctaatgaaggattt
gaatttagcagagataattttggctgtttaattatgcacaagccatctaaaaatccaaat
gctcctaaagttttattagcagcacacatggatgaagttggatatgtagtaagaaatttt
gataaaaaaggacaattatatttatcaacagttggtggcgtatgaccatgtgcagttatt
ggaaccaaagcaaaattaattacttcaaataacgaaacatttattggattatttggacat
acaagtattcatataatgcaagaagaagaaagaaagaaagcaattacagaaaatgaatta
tttgctgattttggtttcaaaagcgatgaagatgctattgctcatggtgttaatgttggt
gatagagtttacatgagcggagaaacaatactatttaatgatcaaaatttaattggtgga
aaagcaatggacaaccgtgctggtgtaaccgtgttagaatttgttgctaaagctgttgca
aaattagatcttgacattgatctatatttagtaggtacggttcaagaagaagttggaaca
agaggagctaaaacagttgcgtctatgattgatccagacatttcaatagcagttgatact
tctgcatctcacgatacacctaatacaattcctggaaatgtttctttatataagggagct
gctttaagattaaaagatagaggaacaatgatggatccaaaattggtacaattttttgtt
gatttatctaagaaatataatattccaacatttaaatatgtagccatgggtggtggtact
gatgcctttgaattacaattttcaaaaggtggggcagccacattaacaatttcattacct
caaagatatttgcattcaccaattggagtatgttgcataagtgatttattggcagccgtt
gatttgttaacaaaatttttaactgattttaaacaatctgattgagaaaatattcaatat
aaataa

DBGET integrated database retrieval system