KEGG   Mycoplasma hominis: MHO_4860Help
Entry
MHO_4860          CDS       T01122                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mho  Mycoplasma hominis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mho00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
605446..606069
Genome map
AA seq 207 aa AA seqDB search
MSKKLIIFTGPSGVGKGTIEKPLFEDKSLKLKLSVSMTTRSPREGEIDGVHYYFVSKDTF
NSCLAENKLIEYSMHFDNYYGTLYSEIERISEQGKIPFLEIETNGAKQILEYYKKRNRLD
EICSIFLMPPSYGELRKRIEGRNTETEDLIIKRMKKAKEEIGYSTIFHHVIVNDDLNVAL
EEIKEIIRSEFSDIINKKEVASEGRKA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaattaataatatttacaggaccaagtggcgttggaaaaggaacaattgaa
aagcccttatttgaagataaaagtctaaagctaaaattgtcagtatcaatgacaacgaga
tcaccacgagaaggagaaattgatggtgtacactattactttgtgtcaaaagatactttt
aactcttgcttagcagaaaataagctaatagaatattcaatgcactttgataattattat
ggaacattatattcagaaattgaacgtattagtgaacaaggaaaaattccatttcttgaa
attgaaactaatggtgctaaacaaattttagaatattataaaaaacgtaacagattggat
gaaatttgttcaatatttttaatgcctccttcatatggagaattaagaaaaagaattgaa
ggtcgcaataccgaaactgaagatctaattattaaaagaatgaagaaagcaaaagaagaa
ataggctattctacaatatttcatcatgtgatagttaatgatgatctaaatgtagcactt
gaagaaatcaaagaaataatcagatcagaattttcagatattataaacaaaaaagaagtt
gcaagtgaaggtagaaaggcataa

DBGET integrated database retrieval system