KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0083Help
Entry
MHP7448_0083      CDS       T00264                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
mhp00240  Pyrimidine metabolism
mhp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MHP7448_0083 (deoA)
Enzymes [BR:mhp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MHP7448_0083 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-ProteinID: AAZ53460
LNCC_Brazil: MHP0083
UniProt: Q4A8S9
Position
complement(104685..105968)
Genome map
AA seq 427 aa AA seqDB search
MSLFEIIEKKSQKHKLSAEEINFMINGFQSGLITDYQFSAFLMAILINGLDDDELFYFTR
EIIASGNTINLSKINGIKIDKHSTGGVGDKISLIIGPIFASLGYKVAKMSGRGLGFTGGT
IDKLESIPGFKTQLTEANFLEQVQKIGLAIVAQSNALVPADKKIYALRDVTGTVSSIPLI
ASSIMSKKIATGADVILIDVKCGNGAFMTELPKAKKLASKIKMLGKKFGKKTIVKITNME
APLGKMIGNKNEIIESLSILQGNQSQLSEFASELVAQTLTELEKIKIEKARKKVKDVIES
GQAYELFLKMVSAQGGNLTLIQSSNFWIPAYKEQIFAPQNGYIKWENALIFGKIVAFLGG
GRTKLNQKIDYEAGISLEVETGEYVQEDQLIFSLYSSSPIDLRQIQDLIPKTFSINPEPE
FEKMFLN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtttattcgaaataattgaaaaaaaatcacaaaaacataaactttcggctgaagaa
attaattttatgatcaacggatttcaaagcggcctaattactgactatcaattttcggct
tttttaatggccattttaattaacggtcttgacgatgatgaacttttttattttacccgc
gaaattatcgcctcaggaaatacaattaatctctcgaaaattaacggaattaaaattgat
aaacactcaacagggggagttggcgataaaatttctttaattattggacctatttttgct
tcccttggttataaagtagcaaaaatgtcaggacgaggacttggttttacaggtggaaca
attgataaattagagtcaatacctgggtttaaaacccaattaactgaggccaatttttta
gaacaagttcaaaaaattgggcttgcaattgttgcccaatcaaatgcacttgttccggct
gataaaaaaatttatgctcttcgagatgtcaccggaacagtttcttcgattccattaatt
gctagttcaattatgtctaaaaaaattgcaactggggccgatgttatccttattgatgta
aaatgtggtaatggcgcttttatgactgaactgccgaaagccaaaaaattagctagtaaa
attaaaatgttagggaaaaaatttggaaaaaaaactatcgttaaaatcactaatatggaa
gcaccgctaggaaaaatgattggaaataaaaatgaaattattgaatctctttcgattctt
caaggaaatcagtcccaacttagtgaatttgcaagcgagttagttgctcaaaccttaaca
gaacttgaaaaaattaaaattgaaaaagcccgcaaaaaagtaaaagatgtaattgaatct
ggtcaagcctatgaactttttttgaaaatggtaagtgctcaaggtggaaatctgacatta
attcagtcctcaaatttttgaattcccgcttataaagagcaaatttttgcgcctcaaaat
ggttatattaaatgagaaaatgccttgattttcggaaaaattgttgcttttttaggtggg
gggagaacaaaattaaaccaaaaaattgactatgaggctggaatctcccttgaggttgaa
accggtgaatatgtccaagaagatcaattaatttttagtctatattcatctagtccaatt
gatcttagacaaatccaggatttaattccaaagacttttagtattaatcctgaacctgaa
tttgaaaagatgtttttaaattaa

DBGET integrated database retrieval system