KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0111Help
Entry
MHP7448_0111      CDS       T00264                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHP7448_0111 (pfkA)
   01230 Biosynthesis of amino acids
    MHP7448_0111 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP7448_0111 (pfkA)
   00030 Pentose phosphate pathway
    MHP7448_0111 (pfkA)
   00051 Fructose and mannose metabolism
    MHP7448_0111 (pfkA)
   00052 Galactose metabolism
    MHP7448_0111 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MHP7448_0111 (pfkA)
Enzymes [BR:mhp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHP7448_0111 (pfkA)
Protein phosphatases and associated proteins [BR:mhp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHP7448_0111 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(153306..154274)
Genome map
AA seq 322 aa AA seqDB search
MSKKIGILTSGGDAPGMNSAISFLTKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNG
ISSFGGTAIGSSRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKV
IALPGTIDNDIQFTDYTIGFDTALNTIVETIDKLRDTANSHRRCFVVEVMGRHCQDLALY
SAMATGSEILITNTNILSPEEVSQKVLEQFAKGKPSVIVTITENILPNLKEFAAKIEELT
KISTRSLEVGHTQRGGRPSAFDRILAAKMAMKAMELINQDKSGLAISYLDGKIQTFDIAK
VVSNPVRKTNDLVLEINKINQN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaatcggtatattaacttcaggcggtgatgcgcctggtatgaattctgca
ataagttttttgacaaaatcagcacttagtttaggttttgagccatatttaatttttgat
ggctattctggaataatcgcaagaaaaatattgccagcaaaaaattttccttataatgga
atttctagttttggcggaactgccataggatcaagtcgctttcctgaatttaaaaaagag
gaagttcaaaataaagccgttgaaattttaagtgaaattgggattagttcgcttgtggta
gtcggtggcgatggaacctataatggcggttataaattacatttaaaaggaataaaagta
atcgctttgccagggaccattgataatgatatccagtttaccgattatacaattggattt
gatactgctttgaatacgatagttgaaactattgataaattaagggatacggcgaattct
catcgtcgttgttttgtagttgaagttatggggagacattgtcaagatttagctttatat
tcggcaatggcaactggaagcgaaattttaattactaatacaaatattttatcccctgaa
gaggtaagtcaaaaagttttagaacagtttgcaaaaggcaaaccaagcgtgatagtaaca
attacagagaatattttaccaaacctaaaagagtttgcggctaaaattgaggagttaaca
aaaatttccactcgctctttagaagttggacatacccagcgcggcggtagaccttcagct
tttgaccgaattttagcagccaagatggcaatgaaagctatggaattaattaatcaagat
aaatcaggccttgcaattagttatttagatggtaaaattcaaacttttgatattgcgaaa
gtagtatcaaatcctgttagaaaaacaaacgacttagtgcttgaaattaataaaatcaat
caaaattaa

DBGET integrated database retrieval system