KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0258Help
Entry
MHP7448_0258      CDS       T00264                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHP7448_0258 (recR)
DNA repair and recombination proteins [BR:mhp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MHP7448_0258 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
312501..313085
Genome map
AA seq 194 aa AA seqDB search
MIKETFKNLAEDLRKIPGISKKQAMRILSFLVDVPIEKIENFVRAICDLKKNTQYCEKCG
YLNTNPVCEICLDFQRSFKILVVENTEMIAKFEEYGKYDGQYFVFGKYDIKNLENHNAQI
KKLADLAANKSEIILGLSSTMEGLIFANYLAKHEFLSGLKITRLATGIPFGAIIDYIDNI
TLDQALKNRQEMEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagaaacatttaaaaatcttgctgaggatttaagaaaaatcccgggaatttcc
aaaaaacaagcaatgcgaattttgtcttttttggttgatgttccaattgaaaaaattgaa
aattttgttagagcaatttgtgatttaaaaaaaaacacacaatattgtgaaaaatgtggg
tatttaaatactaatccagtttgtgaaatatgccttgatttccaacggtcttttaaaatt
ttagtagttgaaaataccgaaatgattgctaaatttgaagaatatggaaaatatgatggt
caatattttgtctttggtaaatatgatattaaaaatttagaaaatcataatgcccaaatt
aaaaaattagctgatttagccgctaataaaagtgagataattcttggtttatcttcgaca
atggagggactgatttttgcaaattatctcgcaaaacacgagtttttatccggccttaaa
attactcggcttgcaactggaattccatttggagcaataattgattatatcgataatatc
accttagatcaagcgcttaaaaatcgacaagaaatggaaaaataa

DBGET integrated database retrieval system