KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0405Help
Entry
MHP7448_0405      CDS       T00264                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MHP7448_0405 (ruvA)
Enzymes [BR:mhp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MHP7448_0405 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
509561..510226
Genome map
AA seq 221 aa AA seqDB search
MQIYQFGKIVSKNKNYLILENHGSGYLIYVPRIDRFSRDENRKIYIYEHENDYTKITYGF
ASFRERILFEDLISIQGVGPKTAISALNSGMQNLINLIAANDWKTLAKIPYLSEKNAKQI
VFEFQKKYERFNENHKNQTEETNQDSQEKELEKNDDLADITIQKSNLEDKTAANLEDTLK
MLGFKPRQIDYALTKVEPNENFENLIENAIKIISNAREFRN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctatcaattcggaaaaattgtctcaaaaaacaaaaactatttaattcttgaa
aaccacggcagtggctatcttatttatgtacctcgaatcgatcgttttagccgcgacgaa
aatcgcaaaatttatatttatgaacatgaaaatgactatacaaaaataacttacggtttt
gcgagcttccgtgagcgcattttgtttgaagatctaatttcaattcaaggggttggacct
aaaaccgcaatttctgcacttaattcgggaatgcagaatttaattaatttaattgccgca
aacgactgaaaaacgctggcaaaaattccttatctttctgagaaaaatgcaaaacaaata
gtctttgaatttcaaaaaaaatacgaaagatttaacgaaaaccataaaaaccaaacagag
gaaacaaatcaagactctcaagaaaaagaactagaaaaaaatgatgatttagctgatatt
accatccaaaaatcaaatcttgaagacaaaacagcagcaaatcttgaggatactttgaaa
atgcttggtttcaaaccacgacaaattgattatgcgcttacaaaagttgaacctaatgaa
aactttgaaaatttaattgaaaacgcaattaaaattatatcaaatgccagagaatttaga
aattag

DBGET integrated database retrieval system