KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0506Help
Entry
MHP7448_0506      CDS       T00264                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHP7448_0506 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP7448_0506 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MHP7448_0506 (pdhC)
   00620 Pyruvate metabolism
    MHP7448_0506 (pdhC)
Enzymes [BR:mhp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MHP7448_0506 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
671452..672369
Genome map
AA seq 305 aa AA seqDB search
MSKILATPKARAMAKQANIDLADLKIQGRKIEASDVENYIKSLKSAQTSAEKVEVSSSQA
EKTSIPAPIPPKLEGKREKIAPIRKAIARAMTNSWNSVAYVNLVNQIDVSDLWKLRKSVL
EPVLKTSGVKLTFLAFIAKAILIALSEFPVMAAKYDEATSEIVYPDTLNLGLAVDTEAGL
MVPVIKDAQKLSIVEIAKEIVRLAKAARERKIKPSEMQGGSFTITNYGSVGSLYGVPVIN
YPELAIAGVGAIIDSAEVKDGQIVASKIMHLTVAADHRWIDGATIGRFAARVKELLEKPE
ILGIL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattttagcaaccccaaaagcaagagcgatggcaaaacaagctaatattgat
cttgctgatcttaaaattcaaggtcggaaaattgaagcttccgatgttgaaaattacata
aaatccttaaaatcagcacaaactagtgctgaaaaagtagaagtttcatcgtctcaggct
gaaaaaacttctattcccgcgccaattccgcctaaattagaaggaaaacgcgagaaaatc
gctccaattcgaaaagcaattgcaagagcgatgactaattcttgaaattcagttgcctat
gtcaacctcgttaatcaaattgacgttagcgatctttgaaaacttagaaaatcagtttta
gagcctgtcctaaaaacatcaggtgtgaaactaacatttcttgcttttattgccaaagcc
attttgattgctcttagtgaatttcctgttatggcagcaaaatatgatgaagcaacaagt
gaaattgtctatcctgatactttaaatttaggtcttgctgtcgatactgaagccgggctt
atggttccagtaattaaagatgctcaaaagctttcaattgtagaaattgcaaaagaaatt
gttcgtcttgccaaagctgcccgtgaacgtaaaattaaaccaagtgaaatgcagggtgga
tcatttacaatcacaaattatggatcagttggttcgctttatggtgttccagtaataaat
tatcctgaacttgcaattgctggagtaggagctattattgattcagccgaggtcaaggat
ggtcaaattgttgcttcaaaaattatgcatttaacagtggctgcagatcatcgttgaatt
gatggggcaacaattggtcgttttgctgcaagagttaaagaattattagaaaaaccagaa
attttaggaatcttataa

DBGET integrated database retrieval system