KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0517Help
Entry
MHP7448_0517      CDS       T00264                                 

Gene name
glck
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHP7448_0517 (glck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP7448_0517 (glck)
   00052 Galactose metabolism
    MHP7448_0517 (glck)
   00500 Starch and sucrose metabolism
    MHP7448_0517 (glck)
   00520 Amino sugar and nucleotide sugar metabolism
    MHP7448_0517 (glck)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MHP7448_0517 (glck)
   00524 Butirosin and neomycin biosynthesis
    MHP7448_0517 (glck)
Enzymes [BR:mhp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MHP7448_0517 (glck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
685025..685894
Genome map
AA seq 289 aa AA seqDB search
MDIGGTNTRFAIFSDNKITKKIKFATDVINYKKILDKILDLVSQYKINAIALCIPGPADY
QKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNTNKGVTQFY
TISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFISGTGMSLRA
KDKNLEQTEPKNIIALSQEDKGYKQIVSDCIDTLARTISITIGILNPNLMVFGGSIAEYN
FWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atcgacatcggcggaacaaatacacgttttgcaatttttagtgataataaaatcacaaaa
aaaattaaatttgccactgatgttataaattataaaaaaattcttgataaaattcttgat
ctagttagtcaatacaagattaacgcaatcgcgttgtgcatccctggtccggctgattat
caaaaagggattattctctcttcgcctaatttaataggctgaaatggaataaatattaag
gaatatctcctaaataattctaaattagaatatgctatctttgaaaatgatgcaaatgca
atggcatttgccaatcatattttttataaaaataccaataaaggcgtaactcagttttat
acaatctcaaccggttttggtgctggactcgtaattaataataaaatttttcatggtgct
aatggttttggacaggaaattgcacatatcccaacttcaaaaatatttaataaaaagcat
cacctaaataattatgcagctgaattatttatctcggggacaggaatgtctttaagagct
aaagataaaaacttagaacaaaccgaaccaaaaaatattatcgcactatctcaagaagat
aaaggctacaaacaaattgttagcgactgtattgataccttggcgcgaacaatttcgata
acaattggaattttaaatcctaatttgatggtttttggcggttctatagctgagtataat
ttttgaataattcaaaaagcgatcaaaaaagcgaaacagtgaacaaataaagaccaatga
gaagctataaagtttgaaaaagatccttttggtgatgattcggctttgtttgggctttac
tacctaatattagaaaaaacaaaaaaataa

DBGET integrated database retrieval system