KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_11010Help
Entry
D650_11010        CDS       T02523                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mhq00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1058346..1058927)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRFGVGKVNSRIGISQEAN
LFTADTNLFAEIKALHSNKALHCILIDEAQFLTKTQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADELEELKTICDCGKKAHFVVRLNEKGEAIKDGEQIQIGGNDRYLS
VCRYHYKQKLGKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttactactcctcaatgaatgcaggcaaatctactactctgctt
caatcttcttataattaccaagaacgtggaatgaacactttagtttataccgccgctatt
gatgaccgtttcggtgtggggaaagtcaactctcgtatcggtatttcacaagaagccaat
ttatttaccgctgataccaatctatttgcggaaattaaggcattacactcaaacaaagcg
ttacactgtatcttgattgatgaggctcagtttttaactaaaacacaggtttatcaatta
agtgatgtggtcgataaactcaaaattccggtgctttgctacgggctacgcaccgatttc
caagctgaattatttgaaggtagcaaatatttgttggcttgggcagatgagctggaagaa
ctcaaaaccatctgtgattgtggcaaaaaagcccattttgtcgttcgattaaatgaaaaa
ggcgaagccattaaagacggtgaacaaatacaaatcggcggcaatgatagatatctctct
gtttgccgttatcattacaaacaaaagttaggtaagctataa

DBGET integrated database retrieval system