KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_13040Help
Entry
D650_13040        CDS       T02523                                 

Definition
Lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Brite
Enzymes [BR:mhq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     D650_13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1265524..1266090)
Genome map
AA seq 188 aa AA seqDB search
MSKSVKVGVFVCSVAAIIGTVKQYYSSEIRTSETGLAIIGNAEGCRRDPYKCPADVITVG
IGSTEASGEKINVNHKYTDKEIAERWIKDLKIAERCINRYFNGDKMNENQFSAMVSAAFN
MGCYNLRFYPNENGKYIQTTIHKYAMAKDFKAMCNRIPDFNRSGGKVLRGLKIRREKEKA
LCLGQEVK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagtgtaaaagttggcgtatttgtctgctccgttgcagctattatcgggacg
gtaaagcaatattacagctccgaaatccgcaccagcgaaacaggcttagccattatcggc
aatgcggagggttgcagacgtgatccgtataaatgccctgccgatgtaatcacggttggc
attggctcaaccgaggcaagcggtgagaaaattaatgtcaatcacaaatacaccgataaa
gagattgccgagcgttggataaaagatcttaaaatagctgaaaggtgtatcaatcgttat
tttaatggcgacaaaatgaacgaaaatcagttttcggcgatggtatcagcagcatttaat
atgggatgttacaaccttagattttatccaaatgaaaatggtaaatacattcagacaaca
atccataaatatgctatggctaaggattttaaagcgatgtgtaataggatacctgatttt
aaccgctcgggaggtaaagtgctaagaggtttgaaaatccgccgagaaaaagaaaaagcc
ctgtgtctcgggcaggaggttaaatga

DBGET integrated database retrieval system