KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_17320Help
Entry
D650_17320        CDS       T02523                                 

Definition
1,4-alpha-glucan branching enzyme GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1675119..1677341)
Genome map
AA seq 740 aa AA seqDB search
MQDYTYSEKDAFFVERLSSGSCNDPFSYLGIHPSNNGVIIRVFLPSAIACQVIDLNGKPV
SSMLKIDDRGFFIAELIGKKTDFSYRLLVEYPDSTVDIEDPYRFKTHIQELDNWLFAEGK
QLRPYEKLGAHLVTQNEVGGVHFSVWAPNAQRVSVVGDFNHWNGLVHSMRFHPDSGIWDI
FLPNVKKGECYKFEVLDRNGVLRLKSDPYAFASQFRPETASIVSGLPSIVPAEKTCRNAN
APDKPISIYEVHLGSWRRNIENNYWLSYEELADELIPYVKDMGFTHIELLPISEFPFDGS
WGYQTTGIYSPTSRFGTPEGLSYFIQKAHDKGIGVILDWVVGHFPVDEHGLVYFDGTHLY
EHSDPKEGYHKDWNTLIFSYGRNEVSNYLSGNALYWIERFGIDALRVDAVASMIYRDYSR
SDGEWIPNKYGGRENLEAIDFLRHTNNILRDESQGGASIAEESTSFAGVSHSTERGGLGF
NYKWNMGWMNDTLRYMQKDPIYRRYHHNLMTFGMTYQYSEQFVLPLSHDEVVHGKGSLLN
KMPGDCWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGKEWNFAESLDWYLLGEEGGEWH
KGVLGWVKALNHLYTQTPALFEQDYNPEGFEWLVVDDHDNSVFAFERKAKNGDSVIVVSN
FTPIVRENYRFGVNELAEYQEILNSDLACYCGSNVSNANRFASELIASHGKAYSLSITLP
PLSTIFLKRAADKKTKQNKT
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactatacttattctgaaaaagatgctttttttgttgagcgactttcttcgggt
tcttgtaatgatcctttctcctacctaggtattcaccctagcaataacggcgttattatt
agggtatttcttccttctgccatagcttgccaagtgatcgatttaaacggaaagcctgtg
tcatcaatgctaaaaattgatgatagaggcttttttattgcagagctgattggtaaaaaa
acagatttttcttaccgcttgttggtggaataccctgattcaacggtggatatagaagac
ccttaccgttttaaaacccatattcaagagcttgataattggttgtttgcggaaggaaaa
caacttcgcccgtacgaaaaattaggcgcacatttagtcacacaaaatgaagttgggggt
gtgcattttagcgtctgggcgccgaacgctcagcgggtttccgtggttggggatttcaac
cactggaacggcttggtacattcaatgcgattccaccccgattccggtatttgggatatt
ttcctgccgaatgtgaaaaaaggggagtgctataaatttgaagtgttggatcgaaacggc
gtgctacggttgaaatccgacccttacgcctttgcctcccaattccgcccagaaaccgca
tctattgtttccggcttgccaagcattgtgccagccgagaaaacctgccgtaatgcgaat
gctcccgataaaccgatttccatttatgaagtgcatttaggctcttggcgacgcaacatt
gaaaacaattattggcttagctatgaagagcttgccgatgaactcattccttatgtgaaa
gatatgggctttacccatattgaattgctgcctatttccgaatttccgtttgatggctct
tggggttatcaaaccaccggtatttattcgccaaccagccgttttggtacgcctgagggc
ttgagttactttatccaaaaagctcacgataaaggcattggtgtgattcttgactgggta
gtggggcattttccggtagatgaacacggcttggtttattttgatggaacgcatttatac
gaacattccgatccgaaagagggctaccacaaagattggaataccttaatttttagctac
ggcagaaatgaggtgagcaattatttgtctggtaatgcactttattggattgagcgtttt
gggattgatgcgttgcgggtggatgcggtggcgtcaatgatttatcgtgattactcacgt
tcagacggcgagtggattccaaataaatatggcggacgtgagaacttagaggcaatcgac
ttcttacgccacaccaataatattttgagagacgaaagccaaggcggtgcgagcattgca
gaggagtccacttcttttgccggagtgtctcactcaactgaaagaggcggtttgggcttt
aattataaatggaatatgggctggatgaacgacactttacgctatatgcaaaaagatcca
atttaccgccgttatcaccacaatttaatgacttttggtatgacctaccaatacagcgaa
cagtttgtgttaccgctttcacacgatgaagttgttcacggcaaaggttcattgctgaat
aaaatgccgggggattgctggcaaaaatttgcgaacttacgagcctattatggctatatg
tggggctatccgggcaaaaaattgctctttatgggcaacgagtttgctcaaggtaaagag
tggaattttgccgagagcttagattggtatttactcggggaagaagggggcgaatggcat
aagggcgtattgggttgggtaaaagcccttaaccatttatacacccaaacccctgcactg
tttgagcaagattacaatcctgaaggttttgagtggttagtggtggacgatcacgataat
tcggtgtttgcttttgagcgtaaagccaaaaatggcgattcggtgattgtggtgagtaat
ttcaccccgattgtgcgtgaaaattaccgttttggggtgaatgaattggcagaatatcag
gaaattctcaattctgatttagcttgttattgcggtagtaatgtcagcaatgcaaaccga
tttgccagcgagttaattgcatcgcacggtaaagcctactccttgagcattactttgcca
ccgctatcgactatcttcctcaaaagagccgcagacaaaaaaacaaaacaaaacaaaaca
taa

DBGET integrated database retrieval system