KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_17830Help
Entry
D650_17830        CDS       T02523                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhq01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mhq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1722194..1723162
Genome map
AA seq 322 aa AA seqDB search
MIVVTSGAAAAGRDYLGHPELPKTLASKQMLAAVGQSQLIRVWENLFDIYNIHIGQMLLT
RADLDDRERFLNARDTLDALLAQKIIPVINENDAVATEEFKVGDNDNLSALVAILAQADQ
LYLLTDQEGLFSADPRSNPDAKLLSVVEKITPEIRQIAGGSSTGLGTGGMSTKITAADIA
TRSGVETIIASGSRPNVLVDLANGQNIGSKFLVQSDRLEGRKRWLFAAPQVGEIVVDFGA
EQALLQHKSLLPVGVSAIKGEFTRGEVIKIFSQDGKALALGIARYSSEALLRIKGKKSKE
IESLLGYEFGSVAVHSDEMVVY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtggtgacatccggagctgccgctgccggtcgggactatttaggacaccctgaa
ctccctaaaaccttagcctctaagcaaatgttagcagcggtcgggcaaagtcagctcatt
cgagtgtgggaaaatttattcgatatttataatatccatatcgggcagatgctcttaacc
cgagccgatctggacgatcgtgaacgtttcctcaatgcccgtgatacccttgatgccctg
cttgcacaaaaaatcattccggtgattaatgaaaacgatgccgttgctaccgaagaattt
aaagtaggcgataacgataatttatcggctttagttgcgattttggctcaagcagatcag
ctctatttattaaccgaccaagaaggcttattcagtgccgatcctcgctcaaaccctgat
gctaaattgctctcggtggtggaaaaaatcacgcctgaaatccgccaaattgccggtggt
agttcaaccggtttaggcacgggcggaatgagtaccaaaattactgctgctgatattgct
acccgctccggtgtggaaaccatcatcgcctccggttctcgcccaaatgtgttagttgat
ttagcaaacgggcaaaacatcggcagtaaatttttagtccaatctgaccgcttggaaggc
agaaaacgctggttatttgctgctccgcaagtgggtgaaattgtggtagatttcggggcg
gaacaagccttgcttcaacataaatcattactgccggtgggagtttctgccatcaaaggc
gaatttactcgaggtgaagtaatcaaaattttcagccaagacggcaaagccttagcactc
ggcattgcccgttatagcagtgaggcattgctgcgaattaaaggtaagaaatcaaaagaa
attgaatcgctccttggttatgaatttggttctgttgcagtgcatagtgacgaaatggtg
gtgtattaa

DBGET integrated database retrieval system