KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_18410Help
Entry
D650_18410        CDS       T02523                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    D650_18410
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    D650_18410
Enzymes [BR:mhq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     D650_18410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1768549..1769652
Genome map
AA seq 367 aa AA seqDB search
MKIDKTLVVKFGTSTLTQGSAKLNLPHMIDIVRQLAQLHQAGFRLVIVTSGAIAAGRHYL
NHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQILLTRADIEDRERFLNARDT
LRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDRDPR
KHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAADVATRSGIETIIAPGNRPN
VIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITIDAGAENAMLIQHKSLLPAGI
VNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGKHSQDIEQVLGYEYGAVAVH
RDDMIVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgacaaaacactcgttgtaaaatttggaaccagtacgcttacgcaaggatcg
gcgaagttaaatttacctcatatgatagatattgtgcgtcagctcgcacagcttcatcaa
gcgggctttcgtttagtgattgttacctcaggggcgattgcggcaggtcgtcattattta
aatcacccgcaattgccaccgacgattgcctcgaaacaattattggctgcggtaggacaa
agtcagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcag
attttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatact
ttgcgcgccttattagacaatcagattattccagtgattaatgaaaatgacgctgtcgct
acgtcagaaattaaagtaggcgataacgataatttatccgcgttagtggcaattttggtg
caagcagaacagttgtatttgcttactgatcagcaaggtttatttgatcgtgatccgcgc
aaacatccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcg
attgcgggcggaagtggcacctcgttaggcacaggtggcatgtccaccaaaatcagtgcc
gcggatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaat
gtgattgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagat
cgcttagaaagtcgtaaacaatggctatatgcggcgccgtcagccggtattattaccatt
gatgcgggggcggaaaacgcgatgttaatacaacataaatcgttattgcctgctgggatt
gtaaacgtggaagggcgcttttcacgcggtgaagtggtaaaaattcgtactcagcaaggc
aaggatgttgccttagggatgccacgttataacagcgatgcgctccatttaattcaaggc
aaacattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacac
cgagacgatatgattgtgttataa

DBGET integrated database retrieval system