KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_27190Help
Entry
D650_27190        CDS       T02523                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    D650_27190
Enzymes [BR:mhq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     D650_27190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2636267..2638030
Genome map
AA seq 587 aa AA seqDB search
MTTLKSTPVKIGIRPTIDGRRLGVRESLEDQTMNMAKAVAQLIQSEVRHPNGDFVECVIA
DSTIGGVAEAAACAEKFKRENVGAVITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGA
VYLAAALAGHSQLGLPAFSIYGTEVQEADDQSIPDDVREKLLRFARAGLAVATLRGKSYL
SIGSVSMGIAGSIVNQQFFQEYLGMRNEYVDMTEIKRRLDRHIYDAEEFKLAMSWVKTYC
KEGIDVNAPENQRSPEEREKLWEDVVKMTIIARDLMVGNPRLAELGYSEEALGHNAIAAG
FQGQRQWTDHLPNGDFMEATLNSTYDWNGVRAPYIMATENDSLNGVNMLFGNLLTGQAQI
FADVRTYWSEDSVERVTGWRPESGFIHLINSGSAALDGTGQHTDRAGKPTIKPAWEVTEE
DGKRCLENTCWCPAVHEYFRGGLSSQFLTKGGMPFTMHRINLIKGIGPVLQIAEGWSIDL
PENVHDILNKRANETWPTTWFVPRLTGKGAFTDVYSVMANWGANHCVATFGHVGADLITL
ASMLRIPVCVHNVEDKDVFRPSAWNGFGQDKEGQDYRACANFGPLYK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgttgaaatctacccctgtaaaaattggtatccgcccaaccattgacggtcgc
cgtttaggagtgcgtgaatcacttgaagatcaaacaatgaatatggcaaaagccgttgca
caattaattcaatctgaagtccgccacccaaatggtgatttcgttgaatgtgtgattgct
gattccaccatcggtggtgttgccgaagctgcggcttgtgcagaaaaattcaaacgtgaa
aatgtcggagcggtgattaccgtaaccccttgctggtgctacggttctgaaaccattgat
atggacccacatatgccgaaagccatttggggctttaacggaacagaacgcccaggtgca
gtttatttagctgctgctttagcaggtcatagccaattaggtttaccggcattctccatt
tatggcacagaagtacaagaagctgacgatcaatctattccagacgatgtgcgtgaaaaa
ttactccgctttgcccgtgccggcttagcagtggcaaccttacgaggaaaatcatattta
tctatcggctctgtttcaatgggtattgccggttctatcgtaaaccaacaattcttccaa
gaatatttgggtatgcgtaacgaatatgtggatatgaccgaaattaaacgccgtttagat
cgccatatttacgatgccgaagaatttaaattagcaatgagctgggtgaaaacctattgc
aaagaaggtattgatgtcaacgcaccggaaaatcaacgcagcccggaagagcgtgaaaaa
ctctgggaagacgtggtgaaaatgaccattattgcccgtgatttaatggtgggtaatcct
cgcttagcagagctaggctatagtgaagaagccttagggcataatgcgattgctgccggt
ttccaagggcaacgccaatggacagaccatttgccaaacggcgattttatggaagctacc
ttgaattcgacctatgactggaacggcgttcgcgcaccatacattatggcaactgaaaac
gacagcttaaatggcgtgaatatgttgttcggtaacttattaaccggtcaggcacaaatc
tttgccgatgtgcggacatactggagcgaagactcggtagaacgtgtcaccggctggcgt
ccggaaagcggttttatccacttaatcaactccggctctgcggcgttagacggaacaggt
cagcataccgatagagcaggcaaaccaactattaaaccggcttgggaagtgactgaagaa
gacggtaaacgttgtttagaaaacacctgttggtgtccggcagttcacgaatatttccgt
ggtggtttatcttcccaattcttaaccaaaggtggaatgccgtttacgatgcaccgtatc
aacctgatcaaaggtatcgggccggttttacaaattgccgaaggttggtctatcgacttg
ccggaaaatgtacacgacattttaaacaaacgcgccaatgaaacctggccgaccacttgg
ttcgtacctcgcttaaccggaaaaggcgcatttaccgatgtgtatagcgtaatggcgaac
tggggtgcaaaccactgtgtggcaaccttcggacacgttggggcagacttaattaccctc
gcctcaatgctccgcattccggtttgtgtgcacaatgtggaagataaagacgtattccgc
ccaagtgcgtggaacggtttcggtcaagacaaagaaggtcaagactaccgtgcttgtgct
aacttcggaccattatataaataa

DBGET integrated database retrieval system