KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_27220Help
Entry
D650_27220        CDS       T02523                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mhq00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2640271..2640876
Genome map
AA seq 201 aa AA seqDB search
MTRIGLNQGTAGNVSVRYKDGMLITPTGTPYEQMTEDSIVFVDGNGKHEEGKLPSSEWQF
HLAVYEARPELNAVVHNHAKNCAAVSILGEPIPAIHYMIACTGTNHIPCVPYAPFGTHQL
ADYVREGIKHSKAILLAHHGLITADKTLEKALGIAHEVEVIAEWYLKLLATGKPIPTLNK
EQMDIVLGKFKSYGSWVESEQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaattgggttaaatcaaggtacagcaggcaatgtgagcgtacgttataaagac
ggtatgctcattacgccaacaggtacaccttatgagcaaatgaccgaagattctatcgtc
tttgttgatggcaacggcaaacacgaagagggaaaactcccttcaagtgagtggcagttc
catttagcggtttatgaggctcgccctgaattaaatgcggtagttcacaaccacgctaaa
aactgtgccgcagtgtctattttaggtgaacctatccctgccattcactatatgatcgcc
tgcaccggcactaatcacattccttgtgtaccttatgccccgttcggcactcaccaatta
gccgactatgtacgtgaaggcattaaacacagcaaagcaattttactcgctcaccacggc
ttaatcaccgcagataaaaccctcgaaaaagccctcggcatcgcccacgaggtggaagtg
atcgcagaatggtatttgaaactgctcgctacaggaaaacctatcccaacgctaaacaaa
gaacaaatggatatcgtactcggaaaatttaagtcctatggttcttgggtggaaagcgaa
caatag

DBGET integrated database retrieval system