KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_6760Help
Entry
D650_6760         CDS       T02523                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(658540..660621)
Genome map
AA seq 693 aa AA seqDB search
MMKITAKQYYRAGIMPYFFDERGVKKTASEKIKHSLFKAFNGNTQARETPIPTVNIFYQH
QPCFLPFHLADKKHPLTGTWQLQLENSNQIISGKIKARGITLPQDLPLGYHQLQLKTVDK
TFNCTIIIAPERCYQPQAVIEQKRLWGTFLQLYTLKSAHNWGIGDFGDLKDFIQQIAPYQ
ADFIGLNPIHSLFPANPNSASPYSPSSRRWLNIAYIDINQLAEFQQSDEAQTWFHSAEIQ
QQLSELRTQDWLNYEQIIPLKLKGLRFAFAKFQQNMTACAAPAFIEFVQKGGESLQVQAT
FDALHQHLSAQFADQWGWDFWEKAYQDYHSAAVQQFRETHKTDIEFYLWLQFVADQQLAE
CDAICRQQNMRIGMYRDLAVGVSPNGAETWNDKQLYCLNASVGAPPDVLGPQGQNWGLTP
MNPHVLKQQAYRPFIELVRANMSHCGALRLDHIMSLLRLWWIPKGDSAVNGAYIRYPVDD
LIAILALESQRHQCLIIGEDLGTVPKEIVSKLKNAGILSYKIFYFEFDEQGKSRDLQHYP
YQAMTTLSTHDLPTINGYWRGYDFELGEKFGVYPNSNILAILKQDRVNAKAKILQRLQEH
NVEIAPEISEQLNSPVNTAFIHCLQTYVANVSSGLFGFQPEDWLGMTEPVNIPGTSTQYA
NWRRRLSVNLEEIFTDKDIQALLKEVNLIRKNQ
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaataactgccaaacaatattatcgggctggaattatgccctattttttcgat
gagcgtggtgtaaaaaaaacagcatctgaaaaaataaaacattcgttattcaaagccttt
aacggcaatactcaagcaagagaaacacctatccctacggtcaacattttttaccagcac
caaccctgttttttaccttttcatttagcggataaaaaacatccgttaaccggtacttgg
cagctacaactagaaaattcaaaccaaattatttccggcaaaattaaagcaaggggaatt
acattacctcaagatttgcccttaggttatcaccaattacagctaaaaacggtagataaa
acctttaattgcaccattattatcgctccggaacgctgctaccaaccacaagccgtcatt
gaacaaaaaagattgtggggaaccttcctacaactatacaccttaaaatcagcccacaac
tgggggattggcgattttggcgatttaaaagacttcattcaacagattgccccttaccaa
gcagattttatcggcttgaacccgattcactcactttttccggcaaacccgaattctgcc
agcccatacagtccatcctctcgccgatggctgaatattgcttacattgatatcaatcag
ctagcggaatttcaacaaagtgatgaagcacaaacttggtttcattctgctgaaatccaa
caacaattatcagaattacgcactcaggattggttgaattacgagcaaatcattccgttg
aaattgaaagggctacgctttgctttcgcaaaatttcagcaaaatatgaccgcttgcgct
gcccctgcttttatcgaatttgtacaaaaaggtggtgaaagcttacaagttcaagccaca
tttgatgcccttcatcagcatctatcggcacaatttgccgaccaatggggctgggatttc
tgggagaaagcctaccaagactaccactccgcagccgtgcagcaatttagagaaacgcat
aaaaccgacatagaattttacctttggttacaattcgttgccgatcaacagctagcagaa
tgtgatgctatctgccgtcagcaaaatatgcgtattggtatgtatcgcgatctcgccgtt
ggcgtcagcccgaatggtgcagaaacgtggaatgacaaacaactttattgcttaaatgcc
tctgtcggcgctccgcctgatgtattaggtccgcaaggacaaaactggggcttaacccca
atgaatccgcatgtattaaagcaacaagcctaccgtccgtttattgagttagtcagagct
aatatgagtcattgcggtgcattacgccttgaccatattatgtctttactccgtttatgg
tggatccccaaaggcgatagtgcggttaatggtgcttatattcgttatccagttgatgat
ttaatcgcaattttggcacttgaaagccaacgccaccaatgcctaattatcggtgaagat
ttaggtactgtgccaaaagaaattgtgagcaagctcaaaaatgcggggattttatcttac
aaaattttctattttgaatttgatgaacaagggaagagtcgagacttacagcattaccct
taccaagcaatgaccacattaagcacccacgatttaccgactatcaatggttattggcgt
ggctatgattttgaattaggcgaaaaattcggcgtctatcctaattcgaatattttggca
atccttaagcaagatcgagtcaatgccaaagccaaaatcttacaacgcttacaagaacat
aacgtagagatcgcacctgaaattagcgagcaacttaattctccggtgaataccgcattt
attcactgtttacaaacctatgttgcaaatgtaagcagcggattattcggcttccaaccc
gaagactggttgggtatgactgagccggttaacattccgggaaccagtacacaatatgca
aactggcgacgtcggcttagtgttaacctcgaggagatcttcacagataaagatattcaa
gccttattaaaagaagttaatttaatccgtaaaaatcaataa

DBGET integrated database retrieval system