KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_7960Help
Entry
D650_7960         CDS       T02523                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00220  Arginine biosynthesis
mhq00250  Alanine, aspartate and glutamate metabolism
mhq00290  Valine, leucine and isoleucine biosynthesis
mhq01100  Metabolic pathways
mhq01110  Biosynthesis of secondary metabolites
mhq01130  Biosynthesis of antibiotics
mhq01210  2-Oxocarboxylic acid metabolism
mhq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D650_7960
   00290 Valine, leucine and isoleucine biosynthesis
    D650_7960
   00220 Arginine biosynthesis
    D650_7960
Enzymes [BR:mhq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     D650_7960
    2.6.1.66  valine---pyruvate transaminase
     D650_7960
Amino acid related enzymes [BR:mhq01007]
 Aminotransferase (transaminase)
  Class I
   D650_7960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGI32065
Position
783719..784936
Genome map
AA seq 405 aa AA seqDB search
MDRFPKSDKLAQVRYDIRGPIHKEALRLEEEGHKILKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQSKGMRGMDVNDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAASTLAGGKAVHYLCDEENEWFPDLEDIKSKITPRTKGILVINPNNP
TGAVYSRQILLEIAELARQHNLIIFADEIYEKIVYDGAVHHHIAALAPDVLTVTYNGLSK
AYRVAGFRQGWMVLSGPKHQAKGFIEGLDMLSSMRLCANTPMQHAIQTALGGYQSINEFV
LPGGRLLEQRNKMHELLVQIPGISCVKAKGALYMFPKIDTEMYGIKDDQKFIYDLLRQEK
VLLVQGSGFNWKKPDHFRVVTLPYAHQIEEAIGRLANFLKTYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttttcccaaatcagataagttagctcaggttcgttacgatatccgtgggcca
attcataaagaggcacttcgcttagaagaagaagggcataaaattttaaaattaaatatc
ggtaacccagccccttttggctttgaagcacccgatgaaattttagtggatgtgattcgt
aatcttccaaccgcacaaggctattgtgattcaaaaggtttgtattctgcccgcaaagcg
attgtgcaatattatcaatcaaaaggtatgcgtggtatggatgtaaacgatgtttacatc
ggcaacggcgtatctgaactgattacaatgtcgatgcaggcgttattaaatgatggcgat
gaaattctaattccaatgcctgattatccgttatggacagcagcttcaaccctagccggt
ggtaaagcagtgcattacctgtgcgatgaagaaaatgagtggttccctgatcttgaagat
attaaatcgaaaatcacgcctcgcactaaagggattttggttatcaacccgaataacccg
accggagcagtgtatagccgtcaaattttgctggaaattgcagaacttgcccgtcagcat
aacttaattatttttgctgacgaaatttatgaaaaaattgtctatgatggtgcggtacat
caccatattgctgctcttgcaccggacgtattaaccgtaacttataacggtttatccaag
gcgtatcgtgttgccggtttccgtcagggctggatggtgctgagcggtccgaagcatcaa
gccaaaggttttattgaagggttggatatgctctcttctatgcgtttatgtgccaatacg
ccgatgcaacacgccattcaaaccgcattaggtggttatcaaagtatcaatgaatttgtg
ttgccgggcggtcgtttgctggaacaacgaaataaaatgcacgaattattggtacaaatt
ccgggtattagctgtgtaaaagcgaaaggggcgttatatatgttcccgaaaattgatacc
gaaatgtacggcattaaagatgaccaaaaattcatctacgatttgttgcgacaagaaaaa
gtgctattagtgcaaggttccggttttaactggaaaaaaccggatcacttccgtgtggta
actttgccttatgcacatcaaattgaagaagcgattggtcgccttgcgaatttcttgaaa
acctatcgtcaagactaa

DBGET integrated database retrieval system