KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_8520Help
Entry
D650_8520         CDS       T02523                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00010  Glycolysis / Gluconeogenesis
mhq00071  Fatty acid degradation
mhq00350  Tyrosine metabolism
mhq00620  Pyruvate metabolism
mhq00625  Chloroalkane and chloroalkene degradation
mhq00626  Naphthalene degradation
mhq00650  Butanoate metabolism
mhq01100  Metabolic pathways
mhq01110  Biosynthesis of secondary metabolites
mhq01120  Microbial metabolism in diverse environments
mhq01130  Biosynthesis of antibiotics
mhq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D650_8520
   00620 Pyruvate metabolism
    D650_8520
   00650 Butanoate metabolism
    D650_8520
  Lipid metabolism
   00071 Fatty acid degradation
    D650_8520
  Amino acid metabolism
   00350 Tyrosine metabolism
    D650_8520
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D650_8520
   00626 Naphthalene degradation
    D650_8520
Enzymes [BR:mhq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     D650_8520
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     D650_8520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AGI32121
Position
complement(842559..845168)
Genome map
AA seq 869 aa AA seqDB search
MAKNTQPFDAQAEVNELVEKGLKALDEFRKLNQEQVDFIVAKASVAALDKHGILAMHAYE
ETGRGVFEDKATKNLFACEYVVNNMRHLKTAGVISEDDVTGITEIADPVGVVCGIAPTTN
PTSTTIFKALIALKTRNPIVFAFHPSAQQSSAHAAQIVRDAAVAAGAPENCIQWITQPSM
EGTSALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKTAKLKQAVYDIV
MSKSFDNGMICASEQAAIVDKEIYAEFIKEMQSYGVYLVNKKEKALLEKYIFGIDKAKDE
NCSGAKLNSAVVGKPAAWIAEQAGFKVPEKTNILLAECAFVGEAEPLTREKLSPVLALLK
SDSTEHGLELSEAMVNFHGLGHSAAIHTENKALAKTFGERVKAIRVIWNSPSTFGGIGDV
YNSFLPSLTLGCGSYGKNSVGNNVSAVNLINIKRVGRRRNNMQWFKVPSKIYFERDSIQY
LKSMHDVHKVMIVTDRSMVDLGFVDRITEQLRQRRNQVMIQFFTDVEPNPSLQTVQRGTE
LMRSFQPDTIIALGGGSPMDAAKIMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRKA
KFVGIPTTSGTGSEVTPFAVITDGDIKYPLADYSLTPTIAIVDPALVMSVPSHVAADTGL
DVLTHATEAYTSILANDYTDGLALQAIKLVFENLEKSVKEFDETAREKMHNASTMAGMAF
ANAFLGICHSMAHKIGGKFHTIHGRTNAILLPHVIRYNGTRPTKVATWPKYTNYVADVRF
QDIARMLGLPAETPEQAVEAYAQAVHDLAVRCGVKMSLREQGVDEQAFLNARRELALHAF
EDQCTPANPRLAMIEDMEAIMTKAYYGKE
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaatacgcaaccatttgatgcccaagcagaagtgaatgagcttgttgaaaaa
ggcttaaaagcccttgatgagtttagaaaactcaaccaagaacaagtggattttattgtc
gctaaagcctctgttgctgcccttgataaacacggtattttagcaatgcacgcttacgaa
gaaaccggacggggtgtgtttgaagacaaagccactaaaaacctgttcgcctgtgagtat
gttgtcaataatatgcgacatttgaaaaccgcaggggtcattagtgaagatgatgtcacc
ggtattaccgaaattgccgaccctgtcggtgttgtctgcggtatcgccccaaccaccaac
ccaacctcaaccaccattttcaaagcgttaatcgcccttaaaacccgtaaccctatcgtt
tttgctttccacccgtctgctcaacaatcttctgcccacgctgctcaaattgtgcgtgat
gctgccgtggctgccggtgcaccggaaaactgtattcaatggattacccagccttcaatg
gaaggtacatctgctttaatgaaacacccgggcattgcaactattttagccaccggcggt
aatgcaatggttgaagccgcttactcttgcggcaaaccggcattaggagttggtgcaggc
aacgtaccggcttatgtagaaaaaaccgctaaattaaaacaagcggtgtatgacattgta
atgtcaaaatctttcgacaacggtatgatttgtgcctctgaacaagcggcgattgtagat
aaagaaatttacgctgagtttattaaagagatgcaatcttacggcgtctatttagtgaac
aaaaaagagaaagccttattggaaaaatacattttcggtattgataaagccaaagatgaa
aactgctcaggtgcaaaactcaattcagcggtggttggcaaaccggctgcgtggattgca
gaacaagccggctttaaagtaccggaaaaaaccaatattctgttagccgaatgtgccttt
gtgggcgaagctgagccacttacccgtgaaaaactttcgcctgtactggctctgttaaaa
tccgactccaccgaacacggtttggaattgtctgaagcgatggtgaatttccacggttta
gggcatagtgccgccattcataccgaaaacaaagccttagccaaaacctttggcgaacgg
gtaaaagccattcgggtgatttggaactcaccatcaacctttggcggtatcggtgatgta
tataactccttcctgccatcgcttacgctgggctgtggttcctacggtaaaaactctgta
ggtaacaacgttagtgcggtgaatttaatcaatatcaaacgtgtgggcagacggagaaat
aatatgcaatggtttaaagtgccatcaaaaatctactttgagcgtgactcaattcaatat
ttgaaatcaatgcacgatgtgcataaagtaatgatcgtaaccgaccgctcaatggttgat
ctcggctttgtggatagaattaccgaacaacttcgccaacgtcgcaaccaagtgatgatt
cagttctttaccgatgttgaaccaaacccaagcctgcaaaccgtacaacgtggtacagaa
ttaatgcgtagcttccagcctgatactatcatcgcacttggtggtggttcaccaatggat
gcagccaaaattatgtggttattctacgaacaaccggaagtcgatttccgtgatttagtg
caaaaatttatggatatccgcaaacgtgcattcaaattcccacaattaggcagaaaagcg
aaatttgtcggcattccaaccacctccggaacaggctctgaagtcacaccgtttgcagta
attaccgatggcgatattaaatatccgctcgctgactactcgcttaccccaaccattgcg
attgtcgatcctgcgttagtaatgtctgtgccgtctcacgttgctgccgacaccggttta
gacgtattaactcacgctaccgaggcttacacatcgattttagccaacgactataccgac
ggcttagccttgcaagccattaagttagtgtttgaaaacttggaaaaatcggtcaaagag
tttgatgaaaccgcccgtgaaaaaatgcacaatgcttccacaatggcagggatggcattt
gccaatgccttcttaggtatttgccactcaatggcacacaaaatcgggggtaaattccac
accatccacggtcgaaccaatgcgattttactgccacacgttattcgctataacggcaca
cgcccaaccaaagtggcaacttggccaaaatacaccaattatgtcgcagatgtgcgtttc
caagatattgccagaatgcttggcttaccggcagaaaccccggaacaagcggtggaagct
tacgcccaagcggtacacgatttagccgttcgttgcggcgtgaaaatgtcgcttcgtgag
caaggcgttgatgagcaagccttcttgaatgcccgccgtgaacttgccctacacgcattt
gaagaccaatgcacaccagcaaacccacgtttggcaatgattgaagatatggaagcgatt
atgactaaagcctactatggcaaggaataa

DBGET integrated database retrieval system