KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_8540Help
Entry
D650_8540         CDS       T02523                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D650_8540
Enzymes [BR:mhq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     D650_8540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847902..848666
Genome map
AA seq 254 aa AA seqDB search
MNVLVTRLDSRGQELVDMLNEQQIFAIHQPLFTIEAGKELPLLPSAISRLKSDDYVFVVS
PNAVDYAAKTLVDTGFHFRSDLKYFAVGQRTAKYLTEKAEQAVIYPIEFENSEGVLALPE
MQNLTDKTILILRADSGRELLAETAVLRGATIQYLECYRREPVTDDIPEKISLCKRLGVD
TIVITSSEILRSLYEQAKADCRAWLFECDLVVVSRRIAKIAKQMGWQEDKIRVSDKADNV
TLMNTLLFKVGKSN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttggtcacacgcctggatagtcgggggcaagaattggtagatatgttgaat
gaacagcaaatttttgctattcatcaaccgctatttacgattgaagccggtaaagaatta
cctttgcttccttcggctatttctcggctaaaatcagacgattatgtatttgttgtttcg
ccgaatgcagtggactatgctgcaaaaacattagtagataccgggttccattttcgttca
gatttgaaatattttgcggtagggcaacggactgcgaaatatttaacagaaaaagctgaa
caagcggtcatttatccgatagaatttgaaaatagcgagggggttttggcattacctgaa
atgcagaatctaactgataaaactattttaattctaagagccgattctgggcgtgagcta
cttgctgaaactgcagtcttgcgtggggcaactattcaatatttggagtgttatcgtaga
gagccggttaccgatgatattcccgaaaaaatcagcttatgtaaacgcttgggagtagat
actattgtgatcaccagtagtgaaattttaagatcactttatgaacaagcgaaagcagat
tgtagagcatggttatttgaatgtgatctggttgtagtgagccggcggattgcaaagata
gctaaacaaatgggctggcaagaagataagattagggtatcggataaagccgataatgta
actttgatgaatacattattatttaaagtgggcaaatctaactag

DBGET integrated database retrieval system