KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_8540Help
Entry
D650_8540         CDS       T02523                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mhq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847902..848666
Genome map
AA seq 254 aa AA seqDB search
MNVLVTRLDSRGQELVDMLNEQQIFAIHQPLFTIEAGKELPLLPSAISRLKSDDYVFVVS
PNAVDYAAKTLVDTGFHFRSDLKYFAVGQRTAKYLTEKAEQAVIYPIEFENSEGVLALPE
MQNLTDKTILILRADSGRELLAETAVLRGATIQYLECYRREPVTDDIPEKISLCKRLGVD
TIVITSSEILRSLYEQAKADCRAWLFECDLVVVSRRIAKIAKQMGWQEDKIRVSDKADNV
TLMNTLLFKVGKSN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttggtcacacgcctggatagtcgggggcaagaattggtagatatgttgaat
gaacagcaaatttttgctattcatcaaccgctatttacgattgaagccggtaaagaatta
cctttgcttccttcggctatttctcggctaaaatcagacgattatgtatttgttgtttcg
ccgaatgcagtggactatgctgcaaaaacattagtagataccgggttccattttcgttca
gatttgaaatattttgcggtagggcaacggactgcgaaatatttaacagaaaaagctgaa
caagcggtcatttatccgatagaatttgaaaatagcgagggggttttggcattacctgaa
atgcagaatctaactgataaaactattttaattctaagagccgattctgggcgtgagcta
cttgctgaaactgcagtcttgcgtggggcaactattcaatatttggagtgttatcgtaga
gagccggttaccgatgatattcccgaaaaaatcagcttatgtaaacgcttgggagtagat
actattgtgatcaccagtagtgaaattttaagatcactttatgaacaagcgaaagcagat
tgtagagcatggttatttgaatgtgatctggttgtagtgagccggcggattgcaaagata
gctaaacaaatgggctggcaagaagataagattagggtatcggataaagccgataatgta
actttgatgaatacattattatttaaagtgggcaaatctaactag

DBGET integrated database retrieval system