KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_8540Help
Entry
D650_8540         CDS       T02523                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00860  Porphyrin and chlorophyll metabolism
mhq01100  Metabolic pathways
mhq01110  Biosynthesis of secondary metabolites
mhq01120  Microbial metabolism in diverse environments
Module
mhq_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D650_8540
Enzymes [BR:mhq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     D650_8540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGI32123
Position
846399..847163
Genome map
AA seq 254 aa AA seqDB search
MNVLVTRLDSRGQELVDMLNEQQIFAIHQPLFTIEAGKELPLLPSAISRLKSDDYVFVVS
PNAVDYAAKTLVDTGFHFRSDLKYFAVGQRTAKYLTEKAEQAVIYPIEFENSEGVLALPE
MQNLTDKTILILRADSGRELLAETAVLRGATIQYLECYRREPVTDDIPEKISLCKRLGVD
TIVITSSEILRSLYEQAKADCRAWLFECDLVVVSRRIAKIAKQMGWQEDKIRVSDKADNV
TLMNTLLFKVGKSN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttggtcacacgcctggatagtcgggggcaagaattggtagatatgttgaat
gaacagcaaatttttgctattcatcaaccgctatttacgattgaagccggtaaagaatta
cctttgcttccttcggctatttctcggctaaaatcagacgattatgtatttgttgtttcg
ccgaatgcagtggactatgctgcaaaaacattagtagataccgggttccattttcgttca
gatttgaaatattttgcggtagggcaacggactgcgaaatatttaacagaaaaagctgaa
caagcggtcatttatccgatagaatttgaaaatagcgagggggttttggcattacctgaa
atgcagaatctaactgataaaactattttaattctaagagccgattctgggcgtgagcta
cttgctgaaactgcagtcttgcgtggggcaactattcaatatttggagtgttatcgtaga
gagccggttaccgatgatattcccgaaaaaatcagcttatgtaaacgcttgggagtagat
actattgtgatcaccagtagtgaaattttaagatcactttatgaacaagcgaaagcagat
tgtagagcatggttatttgaatgtgatctggttgtagtgagccggcggattgcaaagata
gctaaacaaatgggctggcaagaagataagattagggtatcggataaagccgataatgta
actttgatgaatacattattatttaaagtgggcaaatctaactag

DBGET integrated database retrieval system