KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_8640Help
Entry
D650_8640         CDS       T02523                                 

Definition
hydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mhq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
858912..859616
Genome map
AA seq 234 aa AA seqDB search
MRGKPMTTISPELTITENTLSPEAQKVRQALLAKGIETPTVTHTKDKASRRAEIQQHMQA
VLELLGLDLSDDSLEETPHRLAKMYVDEIFSGLDYATFPKITNIENRMKVSEMVLVDDIT
LTSTCEHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQERFTEQILTAFQTI
LETDDVAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVFLEDRETRKEFLGLLNK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgagaggaaaaccaatgacaacgatctcgcccgaattaactatcacagaaaacacgctt
tcgccggaggctcaaaaagttcgccaagccttgttggcaaaaggcattgaaactccgact
gttactcataccaaagataaagccagtcgccgagcagaaatccagcagcatatgcaggca
gttttagaattgctcggtttagatttaagtgatgacagcttagaagaaacgcctcatcgt
ttggcgaaaatgtatgttgatgaaattttcagcgggcttgattatgctaccttcccgaaa
attaccaatattgaaaaccgaatgaaagtcagtgaaatggtgctggtggacgatattact
ttaacttctacctgtgagcatcattttgttactattgacggcaaagtagcggtagcctat
tacccgaaaaaatgggtgattggactctcgaaaatcaaccgtgtcgtgcagttttttgcc
caacgtccgcaggtgcaagagcgttttaccgaacagattttaactgcctttcaaactatt
ttagaaacagacgatgttgcggtgtatgtgaaagccacccatttttgcgtgaaatgccgt
ggcataaaagacaccaatagctatacagttacttctgcctttggcggtgttttcttagaa
gaccgagaaacccgcaaagaatttttaggcttattgaataaataa

DBGET integrated database retrieval system