KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_8640Help
Entry
D650_8640         CDS       T02523                                 

Definition
(GenBank) GTP cyclohydrolase I FolE
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00790  Folate biosynthesis
mhq01100  Metabolic pathways
Module
mhq_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mhq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D650_8640
Enzymes [BR:mhq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     D650_8640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF GST_N_3
Motif
Other DBs
NCBI-ProteinID: AGI32133
Position
857424..858113
Genome map
AA seq 229 aa AA seqDB search
MTTISPELTITENTLSPEAQKVRQALLAKGIETPTVTHTKDKASRRAEIQQHMQAVLELL
GLDLSDDSLEETPHRLAKMYVDEIFSGLDYATFPKITNIENRMKVSEMVLVDDITLTSTC
EHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQERFTEQILTAFQTILETDD
VAVYVKATHFCVKCRGIKDTNSYTVTSAFGGVFLEDRETRKEFLGLLNK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatctcgcccgaattaactatcacagaaaacacgctttcgccggaggctcaa
aaagttcgccaagccttgttggcaaaaggcattgaaactccgactgttactcataccaaa
gataaagccagtcgccgagcagaaatccagcagcatatgcaggcagttttagaattgctc
ggtttagatttaagtgatgacagcttagaagaaacgcctcatcgtttggcgaaaatgtat
gttgatgaaattttcagcgggcttgattatgctaccttcccgaaaattaccaatattgaa
aaccgaatgaaagtcagtgaaatggtgctggtggacgatattactttaacttctacctgt
gagcatcattttgttactattgacggcaaagtagcggtagcctattacccgaaaaaatgg
gtgattggactctcgaaaatcaaccgtgtcgtgcagttttttgcccaacgtccgcaggtg
caagagcgttttaccgaacagattttaactgcctttcaaactattttagaaacagacgat
gttgcggtgtatgtgaaagccacccatttttgcgtgaaatgccgtggcataaaagacacc
aatagctatacagttacttctgcctttggcggtgttttcttagaagaccgagaaacccgc
aaagaatttttaggcttattgaataaataa

DBGET integrated database retrieval system